ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkar khxmulekiywkbphaphkhnadkhxngtwxyang PNG nikhxngifl SVG ni 800 533 phikesl khwamlaexiydxun 320 213 phikesl 640 427 phikesl 1 024 683 phikesl 1 280 853 phikesl 2 560 1 707 phikesl duphaphthimikhwamlaexiydsungkwa ifl SVG 900 600 phikesl khnadifl 848 ibt rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid khwamyx khaxthibayFlag of India svg AEnglisc Indeas FanaCestina Indicka vlajkaCymraeg Baner IndiaDansk Indiens flagDeutsch Flagge IndiensEnglish The Flag of India The colours are saffron white and green The navy blue wheel in the center of the flag has a diameter approximately the width of the white band and is called Ashoka s Dharma Chakra with 24 spokes after Ashoka the Great Each spoke depicts one hour of the day portraying the prevalence of righteousness all 24 hours of it Espanol Bandera de la IndiaEsperanto Flago de Barato Hindio Francais Drapeau de l IndeGaeilge Bratach na hIndiaGaidhlig Bratach na h InnseanInterlingua Bandiera de IndiaInterlingue Flagga del IndiaKernowek Baner EyndaLatina Vexillum IndiaeNederlands Vlag van IndiaNouormand Couleu d IndeNovial Flage de IndiaPlattduutsch Flagg vun IndienPortugues Bandeira da IndiaScots Banner o IndieSlovenscina Drzavna zastava IndijeSvenska Indiens flaggaWalon Drapea d l IndeRusskij Flag IndiiTatarcha tatarca Һindstan bajragyUkrayinska Prapor Indiyiन प ल भ ष भ रतय ग ध व यन प ल भ रतक र ष ट र य झण ड प ल भ रत पत क भ जप र भ रत क र ष ट र य झ ड मर ठ भ रत य र ष ट रध वजस स क तम भ रतस य र ष ट रध वज ह न द भ रत क र ष ट र य ध वजঅসম য ভ ৰতৰ জ ত য পত ক ব ল ভ রত র জ ত য পত ক ব ষ ণ প র য মণ প র ভ রতর ফ র লহ নਪ ਜ ਬ ਭ ਰਤ ਦ ਝ ਡ ગ જર ત ભ રતન ર ષ ટ રધ વજଓଡ ଆ ଭ ରତର ଜ ତ ୟ ପତ କ தம ழ இந த ய த ச யக க ட త ల గ భ రత జ త యపత క ಕನ ನಡ ಭ ರತದ ತ ರ ವರ ಣ ಧ ವಜമലയ ള ഇന ത യയ ട ദ ശ യപത കස හල ඉන ද ය ව ජ ත ක ක ඩ යမ န မ ဘ သ အ န ဒ ယန င င အလ တ 日本語 印度の国旗中文 简体 印度国旗中文 繁體 印度國旗اردو بھارت کا پرچمالعربية علم الهندپښتو د هندوستان بېرغپنجابی ھندستان دا چنڈافارسی پرچم هندދ ވ ހ ބ ސ އ ނ ޑ ޔ ގ ދ ދ wnthi 1947 presentaehlngthima ngankhxngtw based on Flag Code of India 2002 Specification for the National Flag of India Cotton Khadi amended in 1979 CONSTRUCTION SHEET Flag of India country Indiaused by Indiacurrent since 1947 08 15created by Pingali Venkayyaformat 2 3shape rectangularFIAV colours saffron white green blue saffron rendered as RGB 255 103 span style visibility hidden 0 span 31 sikhaw rendered as RGB 255 255 255 siekhiyw rendered as RGB span style visibility hidden 00 span 4 106 span style visibility hidden 0 span 56 sinaengin rendered as RGB span style visibility hidden 00 span 6 span style visibility hidden 00 span 3 141other characteristics flag has 3 horizontal stripes flag contains symbol Dharma chakraphusrangsrrkh rthbalxinediy thitng niwedli praethsxinediycdtngkhunemux ph s 2534 ewbist india gov in ngankhwbkhumraykarhlkthan Q2767140 VIAF 127250499 ISNI 0000000106832228 institution QS P195 Q2767140karxnuyat karichiflniihm Public domain Public domain false falseThis work is in the public domain in India because its term of copyright has expired The Indian Copyright Act applies in India to works first published in India According to the Indian Copyright Act 1957 as amended up to Act No 27 of 2012 Chapter V Section 25 Anonymous works photographs cinematographic works sound recordings government works and works of corporate authorship or of international organizations enter the public domain 60 years after the date on which they were first published counted from the beginning of the following calendar year i e as of 2024 works published prior to 1 January 1964 are considered public domain Posthumous works other than those above enter the public domain after 60 years from publication date counted from the beginning of the following calendar year Any kind of work other than the above enters the public domain 60 years after the author s death or in the case of a multi author work the death of the last surviving author counted from the beginning of the following calendar year Text of laws judicial opinions and other government reports are free from copyright The Indian Copyright Act 1957 is not retroactive so any work in which copyright did not subsist when it commenced did not have its copyright restored and is in the public domain per the Copyright Act 1911 nxkcaknikhunxactxngephimpaysatharnsmbtiinshrthxemrika ephuxrabuwaehtuidngannicungepnsatharnsmbtiinshrthxemrika oprdthrabwangannixacimepnsatharnsmbtiinpraethsthiimidichkdrayaewlakhumkhrxnglikhsiththithisnkwa aelamikhxkahnddanlikhsiththithiyawnankwaxayukhxngphusrangsrrkhbwkipxik 60 pi odyechphaapraethsemksiok 100 pi caemka 95 pi okhlxmebiy 80 pi kwetmalaaelasamw 75 pi switesxraelndaelashrthxemrika 70 pi العربي ة ব ল Deutsch English francais ह न द italiano 日本語 ಕನ ನಡ makedonski മലയ ള मर ठ Nederlands portugues do Brasil sicilianu தம ழ ತ ಳ اردو 繁體中文 Public domain Public domain false falseThis image of a flag is ineligible for copyright and therefore in the public domain because it consists entirely of information that is common property and contains no original authorship For more information see Commons Threshold of originality Logos and flags Flagphaphniepnphaphthng traxarm traaephndin traprathb traphaphphimph tlxdcnekhruxnghmaykhxngthangkarxun sungkarichnganekhruxnghmaydngklawthukcakdaelakhwbkhumodykdhmayxun thiaeykipcakkdhmaylikhsiththiinhlaypraethsewxrchnxun iflxunthiichiflni Ashoka Chakra svg duephim en List of Indian flagsaela en State Emblem of India duephimhmwdhmu Flags of IndiaSVG genesisInfoField sxrsokhdkhxng SVG nitrwcsxbthuktxngaelw iflphaphkrafiksewketxrni srangkhunodyich Inkscape Colours scheme Source 1 India saffron Kesari White India green Navy blueRGB 255 104 32 255 255 255 4 106 56 7 3 141Hexadecimal FF6820 FFFFFF 046A38 07038DCMYK 0 59 87 0 0 0 0 0 96 0 47 58 95 98 0 45Pantone 165 C White 349 C 2738 C This is one of the images forming part of the Valued image set Flags of SAARC member countries on Wikimedia Commons The image set has been assessed under the valued image set criteria and is considered the most valued set on Commons within the scope Flags of SAARC member countries You can see its nomination at Commons Valued image candidates Flags of SAARC member countries khabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixairxngkvsflag of the Republic of Indiabngklaভ রত য প রজ তন ত র র জ ত য পত ক xahrbالعلم الهنديsepnBandera de la Republica de la Indiaexseprnotflago de Baratohindiभ रत क ध वजpycabਭ ਰਤ ਦ ਝ ਡ xssmভ ৰতৰ জ ত য পত ক enpalभ रतक र ष ट र य झण ड oxdiyaଭ ରତର ଜ ତ ୟ ପତ କ etlukuభ రత జ త యపత క singhlඉන ද ය ව ජ ත ක ක ඩ යsolwieniyDrzavna zastava Indijeimthiliभ रत क ध वजoprtueksBandeira da Indiakhuchratભ રત ન ર ષ ટ રધ વજmalayalmഇന ത യ ര ജ യത ത ന റ പത കknnadaಭ ರತದ ಧ ವಜsnskvtभ रत य र ष ट र य ध वजeyxrmnFlagge Indiensepxresiyپرچم هندوستانxurduبھارتی پرچمrsesiyFlag IndiitatarҺindstan bajragyopaelndFlaga Republiki Indiiyipunഇന ത യewiydnamQuốc kỳ Ấn Độixethmthiaesdngxyuiniflniprakxbdwythngchatixinediyepnsylksnkhxngpraethsxinediymedia type xngkvsimage svg xml prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann lasud du ihmkwa 10 10 wnthi ewlarupyxkhnadphuichkhwamehnpccubn03 24 18 mkrakhm 2567900 600 848 ibt Yannsee https commons wikimedia org wiki Commons Administrators 27 noticeboard Blocks and protections File Flag of India svg unprotection05 40 28 kumphaphnth 2566900 600 848 ibt Reverted to version as of 22 22 26 February 2023 UTC Swapnil1101 First of all how do you know that the Indian Gov is actually using Pantone shades there are more coloring systems in the world you know Also my version of the colors are more accurate than yours if we base from Khadi India the source you provided And second your Ashoka Chakra has many errors which you seem to ignore because MapGrid already told you this and you didn t respond to him So please understand your mist 16 40 27 kumphaphnth 2566900 600 4 kiolibt You Can buy a Pantone Guide and Official Flag from Khadi India Karnataka Govt of India and Match Yourself True color and Wheel Dots are exactly same as i reverted Older one has smaller dots 05 22 27 kumphaphnth 2566900 600 848 ibt Reverted to version as of 21 58 17 February 2023 UTC Vikassinghhhh your revert doesn t have sense You changed the code to an imperfect one and changed the colors to the Pantone shades 04 25 27 kumphaphnth 2566900 600 4 kiolibt Reverted04 58 18 kumphaphnth 2566900 600 848 ibt I appreciate all of your work but I still don t undersand why this file uses colors PMS 165 C 349 C 2738 C because I don t find any source that provides this So I ll keep the colors of this version see version of 00 42 6 January 2023 to know why of this colors until someone shares the source 23 46 17 kumphaphnth 2566900 600 826 ibt Sbb1413Reverted to version as of 04 53 10 February 2023 UTC what s wrong with the previous flag23 09 17 kumphaphnth 2566900 600 940 ibt Reverted to version as of 05 10 3 January 2023 UTC 11 53 10 kumphaphnth 2566900 600 826 ibt Synced with new construction sheet File Flag of India construction sheet 2 3 svg which after scaling is consistent with flag sizes 1 2 3 4 amp 6 in the government specifications Please do not upload any more Vexilla Mundi type flags with a Ashoka Chakra radius to hoist ratio of 9 60 That ratio is only applicable to 450 300mm flags The 450 300mm size was added to the govt spec in 1979 for aircrafts on VVIP flights it is listed as 7 it is not a scaled version of 21 00 9 kumphaphnth 2566900 600 4 kiolibt fixing displaying error lasud du ihmkwa 10 10 hnathimiphaphni mihnathiichiflnimakkwa 100 hna raykartxipniaesdnghnathiichiflni 100 hnaaerkethann miraykaretmISO 3166 1 ISO 4217 krungethphmhankhr karprachumexechiy yuorp kaaef kilaoxlimpik khruth khwamrwmmuxthangesrsthkicexechiy aepsifik ckrwrrdimxngokl ckrwrrdirsesiy cakarta cinophnthael chna khna mna chawkaehriyng chawhn spopora siekms tladhlkthrphyniwyxrk tladhlkthrphyaehngpraethsithy tladhlkthrphyotekiyw thwehluxng thwipexechiy thaelxndamn thaxakasyan thngchatixinediy thaka nkaexr nkkhawirphrmaedn nkbinxwkas nangngamckrwal nasa bwkhaw bychaemkh praethskmphucha praethscin praethssaxudixaraebiy praethsyipun praethsturki praethsniwsiaelnd praethsbrasil praethsbruin praethsfrngess praethsphma praethsfilippins praethsmaelesiy praethsrsesiy praethslaw praethssingkhopr praethsxxsetreliy praethsxarecntina praethsxitali praethsxinediy praethsxinodniesiy praethsekahliit praethseyxrmni praethsewiydnam praethsaekhnada praethsaemncu praethsithy pkking phasathmil phasathangkarkhxngxinediy phasamrathi phasamldifs phasasnskvt phasaxurdu phasahindi phasaenpal phasimulkhaephim mhasmuthrxinediy manila muslim rphinthrnath thakur rhsothrsphthrahwangpraeths rangwloneblsakhawrrnkrrm raychuxpraeths dinaedn aelaemuxnghlwng raychuxpraethseriyngtamcanwnprachakr raychuxpraethsaelaekhtkarpkkhrxngeriyngtamkhnadphunthithnghmd wladimir putin wnexkrach sngkhramxaw sngkhramekahli smedcphraknisthathiracheca krmsmedcphraethphrtnrachsuda syambrmrachkumari smedcphraecachalsthi 3 aehngshrachxanackr shprachachati shphaphyuorp shrth shrachxanackr xnuthwipxinediy xksrlatin xawuthniwekhliyr ebxrlin exksbxks 360 exechiytawnxxkechiyngit exechiynekms exechiyit aensaedk otekiyw oxlimpikvdurxn 2012 phudkhuy sngkhramolkkhrngthisxng phudkhuy ethuxkekhahimaly dukarechuxmoyngmayngiflniephimetim karichiflkhamokhrngkar wikixuntxipniichiflni karichbn ab wikipedia org Alahәyla Huhu Aҳәynҭkarrakәa rsia Adunei aҳҭnykalakkәa ryhӡynҵa Ametropolitenkәa ryhӡynҵa Ashablon Abiraҟdyrga India Ashablon IND India karichbn ace wikipedia org Asia India Kuala Lumpur Seunaleuek Navbox with columns Seunaleuek Navbox with columns doc 1 SGM 3 STR Seunaleuek Infobox imperium beulanda Keurajeuen Beulanda Pola Country data India Jagong Seunaleuek IND karichbn ady wikipedia org Indie karichbn af wikipedia org Asie Duitsland Europese Unie Japan Suid Afrika Volksrepubliek China Sanskrit Frankryk Verenigde State van Amerika Verenigde Koninkryk Satelliet Italie Krieket Suid Afrikaanse rand Bevolkingsdigtheid Kanada Britse Statebond Australie Engels Nobelprys vir Vrede Londen Mumbai Moslem Indie Rusland Lys van hoofstede Euro Los Angeles Argentinie Wladimir Poetin dukarichkhamokhrngkarephimetimkhxngiflnikhxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnnchuxeruxngsnFlag of Indiakhwamkwang900khwamsung600