ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkar khxmulekiywkbphaphkhnadkhxngtwxyang PNG nikhxngifl SVG ni 800 480 phikesl khwamlaexiydxun 320 192 phikesl 1 024 614 phikesl 1 280 768 phikesl 2 560 1 536 phikesl duphaphthimikhwamlaexiydsungkwa ifl SVG 1 000 600 phikesl khnadifl 398 ibt rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid khwamyx khaxthibayFlag of Germany 1935 1945 svg Deutsch National und Handelsflagge des Deutschen Reiches von 1935 bis 1945 zugleich Gosch der Kriegsschiffe Das Hakenkreuz ist im Vergleich zur Parteiflagge der NSDAP um 1 20 zum Mast hin versetzt English National flag and merchant ensign of Germany from 1935 to 1945 Plattduutsch Natschonal in Hannelsflagg vun dat Duutsch Riek van 1935 bis 1945 Nederlands Nationale en handelsvlag van het Duitse Rijk van 1935 tot 1945 Portugues Bandeira nacional e insignia mercantil do Reich alemao de 1935 a 1945 Tinha o simbolo da suastica inclinada suastica nazista Russkij Gosudarstvennyj i torgovyj flag Tretego rejha v 1935 1945 godah Flag partii NSDAP Ukrayinska Prapor Tretogo Rejhu 1935 1945 rr Italiano Bandiera nazionale e mercantile della Germania nazista dal 1935 al 1945 Tiếng Việt Quốc kỳ Đức Quốc xa 1935 1945 Flag Regulation of 18 June 1937 Further information about the flag in order to avoid constant vandalism The Reich Flag Act of 1935 Reichsflaggengesetz vom 15 9 1935 stipulated that the Reich and Merchant Flag was to be depicted with the disk slightly shifted to the flag pole RGBl I 1935 No 122 Quotation die Reichs flagge ist ein rotes Rechteck auf dessen Mittelachse etwas nach der Stange verschoben sich eine weisse Scheibe mit einem schwarzen auf der Spitze stehenden HK befindet dessen unterer Schenkel nach der Stange geoffnet ist Verhaltnis der Hohe zur Lange des Flaggentuchs wie 3 5 Translation in English the Reich s flag is a red rectangle with a white disc on its central axis shifted slightly to the flagpole with a black swastika standing on the tip the lower leg of which is open to the flagpole ratio of height to length of the flag cloth as 3 5 As the term slightly was very imprecise and therefore the flag manufacturers did not have exact dimensions a law of 18 June 1937 precisely determined the extent of the displacement see included copy The context is explained in the German language publication of the German Flag Society Der Flaggenkurier No 13 2001 on pages 17 ff Andreas Herzfeld Einige unbekannte Flaggenanderungen 1933 1945 Some unknown flag changes 1933 1945 A summary of the facts can be found in English on the following website with all variants of the swastika flag including the version used from 1933 1935 with the central disk The German swastika flag 1933 1945 www loeser us Detailed specifications and construction sheet FOTW Flags of the World Construction sheet obverse Construction sheet reverse wnthi 2477 hrux 2478aehlngthima RGBl I 1935 No 122phusrangsrrkh German governmentkarxnuyat karichiflniihm phaphniepnphaphthng traxarm traaephndin traprathb traphaphphimph tlxdcnekhruxnghmaykhxngthangkarxun sungkarichnganekhruxnghmaydngklawthukcakdaelakhwbkhumodykdhmayxun thiaeykipcakkdhmaylikhsiththiinhlaypraethskhaptiesthkhwamrbphid aelakhxkhwrrawngekiywkbkdhmay phaphniepnphaphekhruxnghmaythangkar hruxepnphaphthikhlaykbekhruxnghmaythangkar khxngrthbalsngkhmniymaehngchatieyxrmni nasi hruxxngkhkrthiekiywkhxngxun echn ekhruxnghmayswstika hruxekhruxnghmaykangekhnsr sungsalrththrrmnuyaehngshphnthsatharnrtheyxrmni idprakaskhaphiphaksaihpranamtrani inthanasuxaehngkhwamrunaerngaelakhwamirmnusythrrmkhxngxdxlf hitelxr phrxmphwk thungaemwakarichaela hruxaesdngekhruxnghmaydngklaw caepnkarkrathathikhdtxbthbyytiaehngkdhmayinhlaypraeths idaek eyxrmni xxsetriy hngkari opaelnd echkekiy frngess brasil aelapraethsxun thimibthbyytipxngpramkaraesdngekhruxnghmaythangkarkhxngrthbalsngkhmniymaehngchatieyxrmni aelamiidklawthungiwinthini aetwtthuprasngkhkhxngkarxpohldphaphinwikimiediykhxmmxnsni ephuxichpraoychnthangkarsuksaaelaihkhxmulepnsakhy miidmiectnaplukpnihekidkhwamaetkaeykinchatiphuidrbkhwamesiyhaycakrthbalsngkhmniymaehngchatieyxrmniewxrchnxun Flag of Germany 1933 1935 SVG genesisInfoField sxrsokhdkhxng SVG nitrwcsxbthuktxngaelw iflphaphewketxrni srangkhunodyichopraekrmaekikhkhxkhwamColorsInfoFieldichsi sida rendered as RGB span style visibility hidden 00 span 0 span style visibility hidden 00 span 0 span style visibility hidden 00 span 0 sikhaw rendered as RGB 255 255 255 siaedng rendered as RGB 221 span style visibility hidden 00 span 0 span style visibility hidden 00 span 0Nazi Flag German Reich Color Scheme karxnuyatichsiththi Public domain Public domain false falseThis file depicts the flag of a German Korperschaft des offentlichen Rechts corporation governed by public law According to 5 Abs 1 of the German copyright law official works like coats of arms or flags aregemeinfrei in the public domain Since the Federal Republic of Germany is the legal successor of the Weimar Republic as well as of the Third Reich this law is also applicable to flags promulgated before 1945 Note The usage of coats of arms and flags especially those of the Third Reich is governed by legal restrictions independent of the copyright status of the depiction shown here Deutsch English 日本語 한국어 简体中文 繁體中文 khabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixairxngkvsNational flag and merchant ensign of the German Reich during 1935 to 1945 It had on it the symbol of Swastika sepnBandera de Alemania 1935 1945 xahrbعلم الدولة النازية من 1935 إلى 1945rsesiyGosudarstvennyj i torgovyj flag Tretego rejha v 1933 1945 godah Flag partii NSDAPeyxrmnFlagge des Deutschen Reiches von 1935 bis 1945xinodniesiyNazi Germany Flag 1933 1945 turki1935 1945 yillari arasinda kullanilan Nazi simgesi ve bayragifrngessDrapeau national et enseigne marchande du Reich allemand de 1935 a 1945 oprtueksBandeira da Alemanha entre 1935 e 1945finaelndnatsi saksan lippuxitaliBandiera della Germania 1935 1945 yuekhrnDerzhavnij i torgovij prapor Tretogo Rejhu v 1933 1945 rokah Prapor partiyi NSRPNixethmthiaesdngxyuiniflniprakxbdwy prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann lasud du ihmkwa 10 10 wnthi ewlarupyxkhnadphuichkhwamehnpccubn21 57 2 knyayn 25631 000 600 398 ibt Reverted to version as of 21 17 30 June 2020 UTC See above19 47 2 knyayn 25631 000 600 2 kiolibt Reverted to version as of 18 41 30 June 2020 UTC where is it specified as being off centre 04 17 1 krkdakhm 25631 000 600 398 ibt Reverted to version as of 19 10 28 June 2020 UTC the flag is specified as being off center01 41 1 krkdakhm 25631 000 600 2 kiolibt Reverted to version as of 17 46 28 June 2020 UTC why do you want it off centre 02 10 29 mithunayn 25631 000 600 398 ibt Reverted to version as of 15 01 9 May 2020 UTC 00 46 29 mithunayn 25631 000 600 2 kiolibt Center circle and swastic22 01 9 phvsphakhm 25631 000 600 398 ibt TmReverted to version as of 12 50 27 August 2015 UTC 18 51 9 phvsphakhm 25631 000 600 3 kiolibt Reverted to version as of 17 19 4 September 2008 UTC 20 19 23 singhakhm 25601 000 600 373 ibt Reverted to version as of 21 29 12 August 2011 UTC 19 50 27 singhakhm 25581 000 600 398 ibt Add viewBox to ease embedding lasud du ihmkwa 10 10 hnathimiphaphni mihnathiichiflnimakkwa 100 hna raykartxipniaesdnghnathiichiflni 100 hnaaerkethann miraykaretmkxngthphxakasithy karbukkhrxngnxrmxngdi karprakassngkhram kaaephngaextaelntik kilaoxlimpik kunethxr lutheyins khnakrrmkaroxlimpiksakl khxnrath xaedxenaexxr ckrphrrdinopeliynthi 1 ckrphrrdifridrichthi 3 aehngeyxrmni spopora saraeyow sidniy dierk chynam thwipaexntarktika thi 26 thiekxr 1 thiekxr 2 nasieyxrmni naykrthmntrieyxrmni brisebn baresolna ptibtikarbarbarxssa ptibtikarmarektkaredn pridi phnmyngkh pkking paris puntxsurththng phunafayxksarahwangsngkhramolkkhrngthisxng fayxksa phrrkhkrrmkrchatisngkhmniymeyxrmn phrayaphhlphlphyuhesna phcn phhloythin phrawrwngsethx phraxngkhecaphirphngsphanuedch phraecawrwngsethx krmhmunnrathipphngspraphnth phraecawrwngsethx phraxngkhecaxathitythiphxapha futbxlthimchatiyipun futbxlthimchatibrasil futbxlthimchatixarecntina futbxlthimchatieyxrmni mxsok milan miwnik yanrbhumekraa E 100 yuththkarthistalinkrad yuththkarthiedingaekrk yuththewhathibrietn rangwloneblsakhafisiks rioxedcaenor lxndxn lxsaexneclis wladimir putin sngkhramklangemuxngsepn sngkhramcin yipunkhrngthisxng sngkhramolkkhrngthisxng stxkohlm smaphnthfutbxlexechiy shphaphosewiyt satharnrthiwmar hlwngwicitrwathkar wicitr wicitrwathkar hlwngsinthusngkhramchy sinthu kmlnawin hadoxmaha xdxlf hitelxr xxsol xngekla aemrekhil xmsetxrdm xxthoth fxn bismarkh esnthluys edxablits ebxrlin emlebirn emksioksiti exethns ehlsingki aekrharth cherxedxr aeplk phibulsngkhram aextaelnta osl otekiyw orm oxlimpikvdurxn oxlimpikvdurxn 1896 oxlimpikvdurxn 1900 oxlimpikvdurxn 1904 oxlimpikvdurxn 1908 oxlimpikvdurxn 1912 oxlimpikvdurxn 1920 oxlimpikvdurxn 1924 oxlimpikvdurxn 1928 oxlimpikvdurxn 1932 oxlimpikvdurxn 1936 oxlimpikvdurxn 1948 oxlimpikvdurxn 1952 oxlimpikvdurxn 1956 oxlimpikvdurxn 1960 oxlimpikvdurxn 1964 oxlimpikvdurxn 1968 oxlimpikvdurxn 2004 oxlimpikvdurxn 2008 oxlimpikvdurxn 2012 oxlimpikvduhnaw dukarechuxmoyngmayngiflniephimetim karichiflkhamokhrngkar wikixuntxipniichiflni karichbn ab wikipedia org Ashablon Abiraҟdyrga Germania karichbn ace wikipedia org Seunaleuek Country data Jeureuman karichbn af wikipedia org 15 September Nazi Duitsland Adolf Hitler Eva Braun Tweede Wereldoorlog Nobelprys vir Vrede Hannah Arendt Gerhard Schroder Duitse Demokratiese Republiek Angela Merkel Sjabloon Inligtingskas Militere konflik Opstand in die Warskou ghetto Jurgen Stroop Waffen SS Warskou opstand Ferdinand von Sammern Frankenegg Wehrmacht Inval van Pole Spaanse Burgeroorlog Sjabloon Landdata Duitsland Nobelprys vir Chemie Parc des Princes Wernher von Braun Slag van Normandie Ludwig Muller Olimpiese Somerspele 1936 Olimpiese Winterspele 1936 Otto von Bismarck Europese Rugbykampioenskap V 2 vuurpyl Vlag van Duitsland Alfons Rebane FIFA Sokker Wereldbekertoernooi in 1938 FIFA Sokker Wereldbekertoernooi in 1934 Wes Duitsland Nobelprys vir Fisiologie of Geneeskunde Fritz Joubert Duquesne Lys van Nederlandse oorloe Hanns Johst Beleg van Leningrad Joseph Goebbels Slag van Noord Kaap Sjabloon Landdata Nazi Duitsland Slag van Gazala Wilhelm Keitel Erwin Rommel Slag van die Rio de la Plata Konrad Adenauer dukarichkhamokhrngkarephimetimkhxngiflnikhxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnnkhwamkwang1000khwamsung600