ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkar khxmulekiywkbphaphkhnadkhxngtwxyang PNG nikhxngifl SVG ni 800 533 phikesl khwamlaexiydxun 320 213 phikesl 640 427 phikesl 1 024 683 phikesl 1 280 853 phikesl 2 560 1 707 phikesl duphaphthimikhwamlaexiydsungkwa ifl SVG 900 600 phikesl khnadifl 6 kiolibt rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid khwamyx khaxthibayFlag of Uganda svg English Flag of Uganda Kiswahili Bendera ya Uganda Uganda Portugues Bandeira de Uganda Espanol Bandera de Uganda Deutsch Flagge Ugandas Esperanto Flago de Ugando עברית דגל אוגנדה Italiano Bandiera dell Uganda Polski Flaga Ugandy Slovenscina Drzavna zastava Ugande Francais Drapeau de l Uganda Uganda Romană Steagul Ugandei Lietuviu Ugandos veliavawnthi 9 tulakhm ph s 2505aehlngthima From the Open ClipArt Library website phusrangsrrkh tobiaskarxnuyat karichiflniihm Public domain Public domain false falseThis work was first published in Uganda and is now in the public domain because its copyright protection has expired in Uganda by virtue of the non retrospective Copyright and Neighbouring Rights Bill 2004 III 13 or it entered the public domain prior to the commencement of that law on July 24th 2004 by virtue of the previous Copyright Act 1964 details The work meets one of the following criteria a it is a photographic work and 50 years have passed since its creation b it is a computer program audio visual work or sound recording and 50 years have passed since the date of its first publication c it is a literary musical or artistic work that was published before January 1st 1954 and its author died before Jan 1st 2004 d it is a Government work and 50 years have passed since its first publication e it is another type of work and 50 years have passed since the author s death To the uploader Please provide authorship and publication details Public domain Public domain false falsephaphni khadkhunsmbtisahrbkarmilikhsiththi dngnnphaphnicungepn satharnsmbti enuxngcakepnsmbtiswnrwmaelaimmikarrabukhwamepnecakhxng prakasnimiphlthwolkphaphniepnphaphthng traxarm traaephndin traprathb traphaphphimph tlxdcnekhruxnghmaykhxngthangkarxun sungkarichnganekhruxnghmaydngklawthukcakdaelakhwbkhumodykdhmayxun thiaeykipcakkdhmaylikhsiththiinhlaypraethsSVG genesisInfoField sxrsokhdkhxng SVG nitrwcsxbthuktxngaelw iflphaphkrafiksewketxrni srangkhunodyich Other toolskhabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixairxngkvsFlag of Ugandamalayalmഉഗ ണ ടsepnBandera de Uganda mrathiय ग ड द श च झ ड oprtueks brasilBandeira de UgandaSakizayau hata nu Uganda 烏干達 thmilஉக ண ட ந ட ட த ச யக க ட rsesiyFlag UgandyfrngessDrapeau de la Republique d Ougandayiddichפאן אוגאנדעyuekhrnFlag UgandidtchVlag van OegandaopaelndFlaga UgandyewiydnamQuốc kỳ Ugandaixethmthiaesdngxyuiniflniprakxbdwythngchatiyukndaepnsylksnkhxngpraethsyukndawnthisrang wnkxtng9 tulakhm 1962media type xngkvsimage svg xml prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann lasud du ihmkwa 10 10 wnthi ewlarupyxkhnadphuichkhwamehnpccubn07 54 7 thnwakhm 2565900 600 6 kiolibt Reverted to version as of 15 14 9 January 2022 UTC VexilAlpaca just a friendly reminder that I have kindly asked you to stop removing linefeed and tab characters Please don t sabotage this file again 06 28 7 thnwakhm 2565900 600 3 kiolibt Halving code no visible changes 08 18 5 thnwakhm 2565900 600 6 kiolibt Reverted to version as of 15 14 9 January 2022 UTC Reverted There is a lot of value in having code that is readable to humans Please do not remove title tags tabs and line feed characters just for the sake of saving a few bytes 08 03 5 thnwakhm 2565900 600 3 kiolibt Reducing code22 14 9 mkrakhm 2565900 600 6 kiolibt Mike Rohsophtcolor bleed23 11 27 mithunayn 2560900 600 7 kiolibt Tcfc2349fixed07 43 27 mithunayn 2560900 600 7 kiolibt Tcfc2349fixed code07 28 9 kumphaphnth 2555900 600 9 kiolibt code cleanup07 26 9 kumphaphnth 2555900 600 7 kiolibt code cleanup12 53 1 knyayn 2554900 600 7 kiolibt Fry1989new colours based on http www uncommonthought com mtblog linked files museveniBush jpg deeper red less orange y lasud du ihmkwa 10 10 hnathimiphaphni mihnathiichiflnimakkwa 100 hna raykartxipniaesdnghnathiichiflni 100 hnaaerkethann miraykaretmISO 3166 1 ISO 4217 kilamwysaklsmkhrelninoxlimpikvdurxn kilamhawithyalyolkvdurxn 2007 kilawaynainoxlimpikvdurxn 2004 kilahxkkiinoxlimpikvdurxn kilaaebdmintninoxlimpikvdurxn kilaoxlimpik ckrwrrdirsesiy ckrwrrdixxtotmn ckrwrrdixxsetriy hngkari ckrwrrdieyxrmn dchniphaphlksnkhxrrpchn dawethiym thwipaexfrika thbthimaedng sisyhlwngphxphul praethskalngphthna praethsthiimmithangxxksuthael praethsyuknda praethsekhnya praethsaemncu praethsithyinoxlimpik praethsithyinoxlimpikvdurxn 1964 praethsithyinoxlimpikvdurxn 1968 praethsithyinoxlimpikvdurxn 1984 praethsithyinoxlimpikvdurxn 1988 praethsithyinoxlimpikvdurxn 1992 praethsithyinoxlimpikvdurxn 1996 praethsithyinoxlimpikvdurxn 2000 praethsithyinoxlimpikvdurxn 2004 phrarachxanackrlaw phraecawrwngsethx krmhmunnrathipphngspraphnth miokhyn kuerwichkh mik 21 rhsothrsphthrahwangpraeths rthprahar rthsmachikekhruxckrphphaehngprachachati rachwngsching rachwngsoknbxng rachxanackrprsesiy rachxanackrenpal raychuxpramukhaehngrthaelahwhnarthbalpccubn raychuxpraeths dinaedn aelaemuxnghlwng raychuxpraethstamcanwnphupwyorkhexds raychuxpraethstamrabxbkarpkkhrxng raychuxpraethstamxtrakarekid raychuxpraethstamxtrakaresiychiwit raychuxpraethseriyngtamkhwamhnaaennprachakr raychuxpraethseriyngtamcanwnprachakr raychuxpraethseriyngtamdchnikarphthnamnusy raychuxpraethseriyngtamphlitphnthmwlrwminpraeths rakhatlad raychuxpraethseriyngtammulkhathunsarxngrahwangpraeths raychuxpraethsaelaekhtkarpkkhrxngeriyngtamkhnadphunthithnghmd raychuxphuelnsomsrfutbxlkrungethphkhrisetiyn raychuxrhspraethsodyfifa raychuxsnamfutbxleriyngtamkhwamcu raychuxswnstw raychuxaehlngmrdkolkinthwipaexfrika rayphranamphramhakstriythwolktamrchkal smchchaihyaehngshprachachati smedcphrarachathibdisultanhssanl oblekiyh srupehriyyrangwloxlimpiktlxdkal srupehriyyoxlimpikvdurxn 1968 srupehriyyoxlimpikvdurxn 1972 srupehriyyoxlimpikvdurxn 1980 srupehriyyoxlimpikvdurxn 1996 shprachachati shphaphaexfrika shrthinoxlimpik somsrfutbxlnkhrrachsima masda somsrfutbxlrachwithi somsrfutbxlsurasdrthani xksrlatin ekhruxckrphphaehngprachachati ephdckarthhar emecxrliksxkekxr exm 16 aexfrikakhphxxfenchns aexfrikatawnxxk oxlimpikvdurxn oxlimpikvdurxn 1964 oxlimpikvdurxn 1968 oxlimpikvdurxn 1972 oxlimpikvdurxn 1976 oxlimpikvdurxn 1980 oxlimpikvdurxn 1984 oxlimpikvdurxn 1988 oxlimpikvdurxn 1992 oxlimpikvdurxn 1996 oxlimpikvdurxn 2000 oxlimpikvdurxn 2004 oxlimpikvdurxn 2008 oxlimpikvdurxn 2012 oxlimpikvdurxn 2016 oxlimpikvduhnaw oxlimpikeyawchnvdurxn 2010 ithylik phuich Ps test Geography aemaebb UGA aemaebb futbxlliksungsud sthaniyxy futbxl dukarechuxmoyngmayngiflniephimetim karichiflkhamokhrngkar wikixuntxipniichiflni karichbn ab wikipedia org Aҳәynҭkarrakәa rsia Adunei aҳҭnykalakkәa ryhӡynҵa Ashablon Abiraҟdyrga Uganda Ashablon UGA Uganda karichbn ace wikipedia org Afrika karichbn af wikipedia org Afrika Christene Krieket Britse Statebond Engels Londen Lys van hoofstede Operasie Entebbe Lys van lande volgens bevolking Uganda Pan Afrika kleure Swahili Cyril Ramaphosa Idi Amin Kategorie Uganda Ewenaar Lys van lande volgens bevolkingsdigtheid Nederlandse nasionale rugbyspan Lys van lande Sjabloon Landdata Uganda Toetskrieket Lys van internasionale rugbyspanne Lys van lande volgens Menslike ontwikkelingsindeks Lys van lande volgens BBP nominaal per capita Lys van lande volgens BBP koopkragpariteit per capita Lys van lande volgens oppervlak Lys van lande volgens geletterdheidskoers Koffie YouTube Staatsgreep Olimpiese Somerspele 2008 Olimpiese Somerspele 2012 Olimpiese Somerspele 2004 Olimpiese Somerspele 2000 Olimpiese Somerspele 1996 Olimpiese Somerspele 1992 Olimpiese Somerspele 1988 Olimpiese Somerspele 1984 Olimpiese Somerspele 1980 Olimpiese Somerspele 2016 Olimpiese Somerspele 1972 Olimpiese Somerspele 1968 Olimpiese Somerspele 1964 Paralimpiese Somerspele 2008 dukarichkhamokhrngkarephimetimkhxngiflnikhxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnnkhwamkwang900khwamsung600