ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkar khxmulekiywkbphaphkhnadkhxngtwxyang PNG nikhxngifl SVG ni 800 533 phikesl khwamlaexiydxun 320 213 phikesl 640 427 phikesl 1 024 683 phikesl 1 280 853 phikesl 2 560 1 707 phikesl duphaphthimikhwamlaexiydsungkwa ifl SVG 900 600 phikesl khnadifl 127 kiolibt rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid khwamyx khaxthibayFlag of Peru state svg Espanol Pabellon Nacional del Peru English State Flag of Peru Runa Simi Piruw llaqta wiphala wnthi 24 kumphaphnth ph s 2367aehlngthima National Emblems of Peru National Flag State phusrangsrrkh Republic of Peru Republica del Perukarxnuyat karichiflniihm Public domain Public domain false falseThe image of an official symbol was faithfully reproduced from the official document made by a State authority such as ministry or public organization Per COM Peru GOVERNMENT the realization of the national or regional symbol is exempt from copyright by being included in any public interest guideline regulations such as those promulgated in Law No 26902 for establish their obligatory application in official texts as well as regulated in DS 091 2002 PCM modified by DS 056 2008 PCM and related resolutions However in addition to prevailing moral rights as the author and the integrity of the works away from copyright the use of denomination and insignia for non official acts is prohibited under DS 003 2008 PCM as could also its distinctive sign registered in Indecopi for commercial products without prior authorization DL 823 Art 129j phaphniepnphaphthng traxarm traaephndin traprathb traphaphphimph tlxdcnekhruxnghmaykhxngthangkarxun sungkarichnganekhruxnghmaydngklawthukcakdaelakhwbkhumodykdhmayxun thiaeykipcakkdhmaylikhsiththiinhlaypraethsewxrchnxun Alternative versionCurrent flags and coats of arms Construction sheet Civil flag and ensign 1950 present Coat of arms of Peru and for War flag State flag and naval ensign 1825 present Coat of arms for State flag War flag 1950 present Naval jackHistorical flags 1820 proposed flag of Peru Flag of Peru 1821 1822 Flag of Peru 1822 Flag of Peru 1822 1825 Flag of the Peru Bolivian Confederation 1836 1839 Flag of South Peru 1836 1839 SVG genesisInfoField sxrsokhdkhxng SVG nitrwcsxbthuktxngaelw iflphaphkrafiksewketxrni srangkhunodyich Other tools It is easy to put a border around this Flag of the State of Peru Pabellon Nacional del Peru image File Flag of Peru state svg border 96x176px Colours scheme Red WhiteRGB 217 16 35 255 255 255HEX D91023 FFFFFFCMYK 0 93 84 15 0 0 1 0Pantone 485 C WhitekhabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixaireyxrmnDienst und Seekriegsflagge PerussepnFlag of Peru state xitaliBandiera di stato peruvianaixethmthiaesdngxyuiniflniprakxbdwywnthisrang wnkxtng24 kumphaphnth 1824krikxeriynmedia type xngkvsimage svg xml prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann lasud du ihmkwa 10 10 wnthi ewlarupyxkhnadphuichkhwamehnpccubn23 17 9 kumphaphnth 2563900 600 127 kiolibt Corrected path imperfection for ribbon gt gt knot No other changes 23 09 12 knyayn 2562900 600 118 kiolibt Corrected slight imperfections in palm branch and laurel branch Optimized and fixed svg code with code cleanup and reduction No other changes 09 21 25 phvsphakhm 2562900 600 162 kiolibt Tcfc2349reduce size10 21 15 singhakhm 2555900 600 263 kiolibt HuhsunquEscudo centrado S21 47 1 singhakhm 2555900 600 263 kiolibt Huhsunquescudo corregido tamano11 02 3 krkdakhm 2555900 600 315 kiolibt Huhsunquescudo shade brillant amaranth05 13 3 singhakhm 2553750 500 326 kiolibt Huhsunquproporcion palma17 20 8 krkdakhm 2553750 500 329 kiolibt Huhsunquazur17 07 8 krkdakhm 2553750 500 329 kiolibt Huhsunquescudo02 31 29 phvsphakhm 2553900 600 907 kiolibt Huhsunqushield shade of red lasud du ihmkwa 10 10 hnathimiphaphni mihnathiichiflnimakkwa 100 hna raykartxipniaesdnghnathiichiflni 100 hnaaerkethann miraykaretmkhxkahndkartrwclngtrasahrbphlemuxngithy khxnkhaaekhfokldkhph chawhn traaephndinkhxngepru thimchatithilngaekhngkhnfutbxlolk thngchatiepru balaxiods phraecawrwngsethx krmhmunnrathipphngspraphnth futbxlthimchatikhxstarika futbxlthimchatisaxudixaraebiy futbxlthimchatiyipun futbxlthimchatituniesiy futbxlthimchatibrasil futbxlthimchatipanama futbxlthimchatifrngess futbxlthimchatiswitesxraelnd futbxlthimchatiswiedn futbxlthimchatisepn futbxlthimchatixxsetreliy futbxlthimchatixngkvs futbxlthimchatixarecntina futbxlthimchatixihran futbxlthimchatixiyipt futbxlthimchatixurukwy futbxlthimchatiekahliit futbxlthimchatiesxrebiy futbxlthimchatiesenkl futbxlthimchatiednmark futbxlthimchatiebleyiym futbxlthimchatiepru futbxlthimchatiemksiok futbxlthimchatieyxrmni futbxlthimchatiexkwadxr futbxlthimchatiokhrexechiy futbxlthimchatioprtueks futbxlthimchatiopaelnd futbxlthimchatiomrxkok futbxlthimchatiincieriy futbxlthimchatiixsaelnd futbxlhyingthimchatibrasil futbxlolk 1930 futbxlolk 1970 futbxlolk 1978 futbxlolk 1982 futbxlolk 2014 rxbkhdeluxk futbxlolk 2018 futbxlolk 2018 klumsi futbxlolk 2018 rxbkhdeluxk futbxlolk 2018 rxbkhdeluxk ephlyxxf oxexfsi khxnembxl futbxlolk 2018 rxbkhdeluxk ephlyxxfrahwangsmaphnth futbxlolk 2018 rxbkhdeluxk osnxemrikait futbxlolk 2018 rxbchingchnaelis futbxlolk 2018 rxbaephkhdxxk futbxlolk 2022 rxbkhdeluxk rthsmachikshprachachati raychuxthimfutbxlthimchatitamchaya raychuxthnginpraethsepru raychuxrhspraethsodyfifa luys swers wxlelybxlchaychingaechmpxemrikait wxlelybxlhyingchingaechmpxemrikait wxlelybxlhyingthimchatiepru wxlelybxlhyingewildaekrndaechmepiynkhph 1993 wxlelybxlewildaekrndaechmepiynkhph sthitiinfutbxlolk 2018 snamkilaeriysxr snamkilaaehngchatiepru snamkilaothoyta smchchaihyaehngshprachachati smaphnthfutbxlxemrikait smaphnthfutbxlexechiy shprachachati xbdulxasis buetflika enlsxn wilefrod obniya snechs ephlngchatiepru exstacixuduomrungbi aecrdn chachiri aedeniyl setxrridc okpaliebrtaoders okpaxaemrika okpaxaemrika 2011 okpaxaemrika 2011 rxbchingchnaelis okpaxaemrika 2015 okpaxaemrika 2015 rxbchingchnaelis okpaxaemrika 2015 rxbaephkhdxxk okpaxaemrika 2019 okpaxaemrika 2019 klumex okpaxaemrikaesnetnariox okpaxaemrikaesnetnariox klumbi okpaxaemrikaesnetnariox rxbaephkhdxxk odkls kxsta oprxiowluchnsxkekxr 2009 oprxiowluchnsxkekxr 2014 oraebrtu firminu aemaebb 2019 Copa America group tables aemaebb Country data Peru aemaebb tarangkhaaennfutbxlolk 2018 klumsi aemaebb tarangkhaaennfutbxlolk 2018 rxbkhdeluxk osnxemrikait aemaebb tarangkhaaennokpaxaemrika 2015 klumsi aemaebb thimfutbxlinfutbxlolk 2018 dukarechuxmoyngmayngiflniephimetim karichiflkhamokhrngkar wikixuntxipniichiflni karichbn ab wikipedia org Ashablon Abiraҟdyrga Peru karichbn af wikipedia org Sjabloon Landdata Peru Vlag van Peru karichbn als wikipedia org Vorlage Info ISO 3166 2 PE karichbn alt wikipedia org Oroondordyҥ toozy Ӱleker Perunyҥ maanyzy karichbn ami wikipedia org Peru karichbn am wikipedia org ፔሩ karichbn ang wikipedia org Peru Flocc Peru karichbn an wikipedia org Organizacion d as Nacions Unidas Real Zaragoza Organizacion d as Ciudaz d o Patrimonio d a Humanidat Sao Paulo Lista de plantillas d o Real Zaragoza Aliaus Primera Guerra Mundial karichbn arc wikipedia org ܐܡܪܝܩܐ ܬܝܡܢܝܬܐ ܩܠܒܐ PER karichbn ar wikipedia org هان مجموعة إثنية منتخب بولندا لكرة القدم منتخب البرتغال لكرة القدم منتخب صربيا لكرة القدم منتخب إسبانيا لكرة القدم منتخب إيطاليا لكرة القدم منتخب فرنسا لكرة القدم منتخب ألمانيا لكرة القدم منتخب تونس لكرة القدم منتخب كوريا الجنوبية لكرة القدم منتخب المكسيك لكرة القدم منتخب كوستاريكا لكرة القدم منتخب الأرجنتين لكرة القدم منتخب البرازيل لكرة القدم منتخب الإكوادور لكرة القدم منتخب باراغواي لكرة القدم منتخب أستراليا لكرة القدم كوبا ليبرتادوريس منتخب العراق لكرة القدم منتخب بيرو لكرة القدم منتخب المغرب لكرة القدم منتخب رومانيا لكرة القدم كوبا أمريكا منتخب الأوروغواي لكرة القدم كاكا أفضل 125 لاعب كرة قدم حي كأس العالم 1982 قائمة العواصم الوطنية كونميبول غونزالو هيغواين تصنيف فيفا العالمي للرجال كأس الكونكاكاف الذهبية dukarichkhamokhrngkarephimetimkhxngiflnikhxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnnkhwamkwang900khwamsung600