ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkar khxmulekiywkbphaphkhnadkhxngtwxyangni 528 599 phikesl khwamlaexiydxun 211 240 phikesl 423 480 phikesl 676 768 phikesl 902 1 024 phikesl 1 804 2 048 phikesl 2 841 3 225 phikesl duphaphthimikhwamlaexiydsungkwa 2 841 3 225 phikesl khnadifl 11 39 emkaibt chnidimm image jpeg rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid nikhuxphaphkhdsrrinwikiphiediyphasahibru תמונות מומלצות aela khux thuxwaepn phaphxyangidxyanghnungthidithisud thakhidwaiflnikhwrcaihkhwamsakhykbwikimiediykhxmmxnsepnxyangdi xyalngelthica esnxchux hakkhunmiphaphthimikhunphaph khlaykhlungkn thicasamarthephyaephridtam syyaxnuyatthiehmaasm ihaenicwa khunid xpohld kahndsyyaxnuyat aelaid esnxchuxaelw khwamyx khaxthibayDegradation alfred dreyfus jpg English Alfred Dreyfus stripped of rank English Cashiering of Alfred Dreyfus English The traitor Degradation of Alfred Dreyfus degradation in the Morland Court of the military school in Paris Francais Le traitre Degradation d Alfred Dreyfus degradation dans la Cour Morland de l Ecole militaire a Paris une du supplement illustre du Petit Journal dimanche 13 janvier 1895 עברית אלפרד דרייפוס מורד מדרגתוwnthi 13 mkrakhm ph s 2438aehlngthima This file comes from Gallica Digital Library and is available under the digital ID bpt6k7161044 f1 This tag does not indicate the copyright status of the attached work A normal copyright tag is still required See Commons Licensing Other languages العربية ব ল catala Deutsch English espanol francais galego עברית magyar italiano 日本語 makedonski Nederlands portugues russkij slovenscina ukrayinska 简体中文 繁體中文 phusrangsrrkh Henri Meyer 1841 1899 chuxxun Reyem Henri Mayer Jacques Meyerkhaxthibay French caricaturist aela citrkrphaphprakxbwnekid wnesiychiwit 6 minakhm ph s 2384 18 krkdakhm ph s 2442 sthanthiekid sthanthiesiychiwit muwlusThiaisngankhwbkhumraykarhlkthan Q3131638 VIAF 96603524 ISNI 0000000110574911 ULAN 500124916 LCCN no2016080312 GND 142946001 WorldCat creator QS P170 Q3131638ewxrchnxun karxnuyatichsiththi phaphniepnphaphthiekidcakkarthasaenaphaphhruxsilpkrrmsxngmiti sungtwphaphtnchbbthithukthasannepnsatharnsmbtidwyehtuphltxipni Public domain Public domain false falsenganniepnsatharnsmbti inpraethstnkaenidaelapraethsxun thirayaewlakarkhumkhrxnglikhsiththinxykwa 100 pihlngcakphusrangsrrkhnganesiychiwit nganniepnsatharnsmbtiinshrthxemrika enuxngcakidrbkarephyaephr hruxkhuncdthaebiyntxsanknganlikhsiththiaehngshrth kxnwnthi 1 mkrakhm kh s 1929iflniidthukrabuwaimmikhxcakdphayitkdhmaylikhsiththi rwmthungsiththithiekiywkhxngaelathiiklekhiyngknhttps creativecommons org publicdomain mark 1 0 PDM Creative Commons Public Domain Mark 1 0 false false mulnithiwikiphiediymimummxngxyangepnthangkarinkrniniwa karthasaenaphaphhruxsilpkrrmsxngmitithiepnsatharnsmbti thuxwaphaphthiidcakkarthasaenaepnsatharnsmbti karxangphlngandngklawepnnganswnbukhkhlepnkarkhdtxaenwkhidekiywkbsatharnsmbti sahrbkhxmulephimetim duthi emuxidcaichpay PD Art karthasaenakhxngphaphnisungepnsatharnsmbti thuxidwaphaphthiekidcakkarthasaenaepnsatharnsmbtiechnkn oprdthrabwakarnaphaphniipichxacthukcakdhruxhamichinekhtxanacsalkhxngthan thngnikhunkbkdhmaythxngthinthibngkhbichinphunthinn duephimthi karnaphaphhruxsilpkrrmsxngmitiipichkhabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixairhibruפרשת דרייפוסxitaliCerimonia di degradazione di Alfred Dreyfus nel cortile della Scuola Militare opaelndDegradacja Dreyfusa po skazaniu za zdradeixethmthiaesdngxyuiniflniprakxbdwywnthisrang wnkxtng13 mkrakhm 1895krikxeriyn prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann wnthi ewlarupyxkhnadphuichkhwamehnpccubn22 30 26 krkdakhm 25582 841 3 225 11 39 emkaibt Madelgariusimproved quality06 14 22 krkdakhm 25573 189 3 872 4 87 emkaibt Underlying lkimproved quality15 19 28 emsayn 2556530 600 78 kiolibt Color22 17 14 knyayn 2548530 600 62 kiolibt Summary Original Name M Meyer Degradation d Alfred Dreyfus 13 janvier 1895 Licence Domaine public PD Source http expositions bnf fr zola images z385 jpg Licencing PD Art 03 20 22 phvsphakhm 2548212 247 39 kiolibt Degradation d Alfred Dreyfus Licence DomainePublic Source http cti itc virginia edu jrh9e dreyfus De la Wikipedia Francaise hnathimiphaphni hnatxipni oyngmathiphaphni ehtukarnaedrfus karichiflkhamokhrngkar wikixuntxipniichiflni karichbn af wikipedia org Alfred Dreyfus karichbn ar wikipedia org ظلم قضية دريفوس محاكمة شكلية بوابة عقد 1890 بوابة عقد 1890 واجهة karichbn ast wikipedia org Inxusticia karichbn avk wikipedia org Basekavara va Alfred Dreyfus yunkexa karichbn bg wikipedia org 22 dekemvri karichbn br wikipedia org Afer Dreyfus karichbn ca wikipedia org Viquipedia Efemerides seleccionades Juliol Plantilla Juliol 21 Afer Dreyfus karichbn cs wikipedia org 19 stoleti Antisemitismus Dreyfusova afera karichbn cv wikipedia org Drejfus ӗҫӗ karichbn da wikipedia org Dreyfus affaeren Bruger Palnatoke Autolister Modsat karichbn de wikipedia org 5 Januar 1895 Dreyfus Affare Alfred Dreyfus Degradierung Rang Diskussion Schutzenschnur Wikipedia Diskussion Hauptseite Artikel des Tages Archiv Vorschlage 2010 2 Wikipedia Loschkandidaten 20 Marz 2011 Kassation Militar karichbn el wikipedia org Ypo8esh Ntreifoys Trith Gallikh Dhmokratia karichbn en wikipedia org Treason 1895 1890s Dreyfus affair Alfred Dreyfus Ferdinand Walsin Esterhazy Investigation and arrest of Alfred Dreyfus Georges Picquart s investigations of the Dreyfus affair Other investigations of the Dreyfus affair Template Dreyfus affair Wikipedia Today s featured article April 2004 Wikipedia Today s featured article April 9 2004 Georges Picquart Resolution of the Dreyfus affair Portal Law Case Week 22 2006 Cashiering History of far right movements in France Hubert Joseph Henry Reduction in rank J Accuse dukarichkhamokhrngkarephimetimkhxngiflnikhxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnnkarcdwangphaphpktikhwamlaexiydaenwnxn72 dpikhwamlaexiydaenwtng72 dpisxftaewrthiichAdobe Photoshop CS3 Windowsaekikhphaphlasud17 27 26 krkdakhm 2558sepssisRGBkhwamkwangkhxngphaph2 841 phikeslkhwamsungkhxngphaph3 225 phikeslewlathiaeplngepndicithl19 13 26 krkdakhm 2558wnthiaekikhkhxmulemtalasud19 27 26 krkdakhm 2558