ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkar khxmulekiywkbphaphkhnadkhxngtwxyangni 351 599 phikesl khwamlaexiydxun 140 240 phikesl 606 1 034 phikesl duphaphthimikhwamlaexiydsungkwa 606 1 034 phikesl khnadifl 76 kiolibt chnidimm image jpeg rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid khwamyx Eleanor Roosevelt with Marshall and Mrs Pibul Songgram of Thailand at Hyde Park New York phusrangsrrkh Unknown authorUnknown author hrux not provided translateRecord creatorInfoFieldRoosevelt Franklin D Franklin Delano 1882 1945chuxeruxng Eleanor Roosevelt with Marshall and Mrs Pibul Songgram of Thailand at Hyde Park New Yorkwnthi 11 phvsphakhm ph s 2498date QS P571 1955 05 11T00 00 00Z 11karekbrwbrwm National Archives and Records Administration chuxinphasatnchbb National Archives and Records Administrationhnwynganaem rthbalklangaehngshrthxemrika thitng wxchingtn di si headquarters and many regional facilities and presidential libraries nationwide in the USAphikd 38 53 34 ehnux 77 01 23 tawntk cdtngkhunemux 19 mithunayn ph s 2477 ewbist www archives govngankhwbkhumraykarhlkthan Q518155 VIAF 132254586 ISNI 0000000121603036 ULAN 500263780 Open Library OL132313A LCCN n84176101 WorldCat institution QS P195 Q518155 Franklin D Roosevelt Library NLFDR 4079 Albany Post Road Hyde Park NY 12538 1999 Record IDInfoFieldSeries Franklin D Roosevelt Library Public Domain Photographs compiled 1882 1962 National Archives Identifier 195301 NAIL Control Number NLR PHOCO A 56147 8 aehlngthima U S National Archives and Records Administrationewxrchnxun Please do not overwrite this file any cropping or other restoration work should be uploaded with a new name and linked in this page s other versions parameter so that this file represents the exact file found in the NARA catalog record to which it links The metadata on this page was imported directly from NARA s catalog record additional descriptive text may be added by Wikimedians to the template below with the description parameter but please do not modify the other fields translate Note Editors who post this notice are strongly encouraged to add details explaining how it applies to this file This file has an extracted image PPS 2 cropped JPG tif jpg iflnithukaeykmacakiflxun Eleanor Roosevelt with Marshall and Mrs Pibul Songgram of Thailand at Hyde Park New York NARA 195948 jpgkarxnuyatichsiththi This file was provided to Wikimedia Commons by the National Archives and Records Administration as part of a cooperation project The National Archives and Records Administration provides images depicting American and global history which are public domain or licensed under a free license العربية blgarski Deutsch English Esperanto espanol francais Ido 日本語 한국어 makedonski മലയ ള Nederlands portugues russkij Turkce ukrayinska 简体中文 繁體中文 正體中文 臺灣 Public domain Public domain false falsenganniepn satharnsmbti inpraethsshrthxemrika enuxngcakepnngankhxngrthbalklangshrthxemrika thngni tamkhwamkhxngmatra 105 hmwd 1 lksna 17 aehngpramwlkdhmayshrthxemrika duephimthi likhsiththi hmayehtu khxkhwamkhangtnichbngkhbaekngankhxngrthbalklangshrthxemrikaethann ngankhxngrthid inshrthxemrika dinaedn ekhruxckrphph ethsmnthl ethsbal hruxxngkhkrpkkhrxngswnthxngthinxunid imthuxepnnganthiepnsatharnsmbtitampramwlkdhmayni nxkcakni aemaebbniimichkbtraiprsniyakraebbid thikrmiprsniyaehngshrthxemrika naxxkichtngaet kh s 1978 ph s 2521 epntnma sungmilikhsiththiaelaimepnsatharnsmbti duraylaexiydthi raebiybaehngsanknganlikhsiththi bthyxthi 2 khx 206 02 b iflniidthukrabuwaimmikhxcakdphayitkdhmaylikhsiththi rwmthungsiththithiekiywkhxngaelathiiklekhiyngkn https creativecommons org publicdomain mark 1 0 PDM Creative Commons Public Domain Mark 1 0 false falsekhabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixairixethmthiaesdngxyuiniflniprakxbdwysthanalikhsiththisatharnsmbtimedia type xngkvsimage jpeg prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann wnthi ewlarupyxkhnadphuichkhwamehnpccubn19 37 13 tulakhm 2550606 1 034 76 kiolibt Mr Tan Summary Source http narademo umiacs umd edu cgi bin isadg viewobject pl object 11056 with Marshall and Mrs Pibul Songgram of Thailand at Hyde Park New York 1955 Licensing PD USGov Category Prime minis hnathimiphaphni hnatxipni oyngmathiphaphni khnarthmntriithy khnathi 10 khnarthmntriithy khnathi 26 khnarthmntriithy khnathi 9 cnghwdnnthburi pramwlkdhmaywithiphicarnakhwamxaya praethsithy pramwlkdhmayaephngaelaphanichy aeplk phibulsngkhram orngphyabalxannthmhidl sthaniyxy karemuxng ruihmwathnghmd karichiflkhamokhrngkar wikixuntxipniichiflni karichbn af wikipedia org Plaek Phibunsongkhram karichbn ast wikipedia org Tailandia na Segunda Guerra Mundial karichbn ba wikipedia org Tailand tarihy 1932 1973 karichbn de wikipedia org 11 Juni Plaek Phibunsongkhram Rajabhat Universitat Pibulsongkram Diskussion Putsch in Siam 1933 Putsch in Thailand 1957 Wikipedia Diskussion Hauptseite Artikel des Tages Archiv Vorschlage 2014 Q2 Wikipedia Hauptseite Archiv 11 Juni 2014 Liste der Biografien Pla karichbn en wikipedia org Plaek Phibunsongkhram User Clumsily Supreme Court of Justice of Thailand karichbn es wikipedia org Tailandia en la Segunda Guerra Mundial karichbn fa wikipedia org پلک پیبونسونگکرام karichbn fr wikipedia org Histoire de la Thailande karichbn he wikipedia org פלק פיבונסונגרם karichbn it wikipedia org Plaek Phibunsongkhram Invasione giapponese della Thailandia Rivoluzione siamese del 1932 Khana Ratsadon karichbn ja wikipedia org 第二次世界大戦の背景 karichbn ko wikipedia org 태국의 역대 내각 karichbn mr wikipedia org प ल क ब प लस ग र म karichbn ms wikipedia org Plaek Phibunsongkhram karichbn my wikipedia org ပလက ဖ ဘ ဆ န ခရမ karichbn nl wikipedia org Plaek Pibul Songkram Lijst van personen overleden in 1964 Gebruiker RonnieV Lijst van personen geboren in 1897 Gebruiker RonnieV Lijst van personen geboren op 14 juli Gebruiker RonnieV Lijst van personen overleden op 11 juni Gebruiker RonnieV Lijst van personen overleden in 1964 Gebruiker RonnieBot afbeeldingen 15 1000 karichbn no wikipedia org Thailands historie karichbn pl wikipedia org Plaek Pibulsongkram karichbn pt wikipedia org Historia da Tailandia 1932 1973 karichbn ru wikipedia org Istoriya Tailanda 1932 1973 Marshal Korolevskih Tailandskih VVS karichbn uk wikipedia org Plek Pibunsongram karichbn vi wikipedia org Người Thai gốc Hoa karichbn yo wikipedia org Plaek Pibulsonggramkhxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnn error0