ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkar khxmulekiywkbphaphkhnadkhxngtwxyang PNG nikhxngifl SVG ni 512 256 phikesl khwamlaexiydxun 320 160 phikesl 640 320 phikesl 1 024 512 phikesl 1 280 640 phikesl 2 560 1 280 phikesl duphaphthimikhwamlaexiydsungkwa ifl SVG 512 256 phikesl khnadifl 109 kiolibt rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid khwamyx khaxthibayFlag of Canada 1921 1957 svg English The Canadian Red Ensign used between 1921 and 1957 This image has compared for accuracy mainly colors using an image from World Statesmen The only change is making the maple leaves green from red This image has compared for accuracy mainly colors using an image from World Statesmen The most recent version of this image has changed the harp into one with a female figure see http flagspot net flags ca 1921 html FOTWwnthi Original design 1921 This file 2007aehlngthima This vector image includes elements that have been taken or adapted from this file Canadian Red Ensign svg This vector image includes elements that have been taken or adapted from this file Green Ensign svg World Statesmenphusrangsrrkh Hoshiekarxnuyat karichiflniihm Public domain Public domain false falsenganniidthukephyaephrsusatharnsmbtiodyecakhxng Hoshie sungmiphlthwolk inbangpraeths karkrathadngklawxacimsamarththaidtamkdhmay Hoshie xnuyatihthukkhnmisiththiinkarichiflniinthukehtuphlkarich odyimmimienguxnikh ewnaetkdhmayimxnuyatihthaechnnnewxrchnxun Flags of Canada 1868 to Current 1868 to 1921 1905 to 1922 This version includes all provincial emblems 1921 to 1957 1957 to 1965 1965 to Current iflxunthiichiflni Proposed Civil Ensign of Jersey svg SVG genesisInfoField sxrsokhdkhxng SVG nitrwcsxbthuktxngaelw iflphaphkrafiksewketxrni srangkhunodyich InkscapekhabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixairxngkvsFlag of the Dominion of CanadarsesiyFlag Dominiona Kanadaixethmthiaesdngxyuiniflniprakxbdwyflag xngkvsswnprakxbthimikhunsmbtini praethsaekhnadasthanalikhsiththicopyrighted dedicated to the public domain by copyright holder xngkvssyyaxnuyatreleased into the public domain by the copyright holder xngkvsmedia type xngkvsimage svg xml prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann lasud du ihmkwa 10 10 wnthi ewlarupyxkhnadphuichkhwamehnpccubn16 07 15 minakhm 2564512 256 109 kiolibt Reduced the file size09 38 10 minakhm 2564512 256 217 kiolibt Changed the insides of the leaves to be black rather than gold02 32 5 thnwakhm 25631 000 500 189 kiolibt In order to match the flag of Canada from 1957 the shield must be in the same shape 09 50 29 tulakhm 25631 000 500 57 kiolibt Reverted to version as of 03 05 14 November 2019 UTC 17 11 31 thnwakhm 25621 000 500 189 kiolibt Reverted to version as of 19 16 14 June 2019 UTC 10 05 14 phvscikayn 25621 000 500 57 kiolibt Tcfc2349reduce size23 10 17 knyayn 25621 000 500 64 kiolibt Great BrightstarRework some color shades07 53 13 singhakhm 25621 000 500 64 kiolibt Simplified Irish Harp to fit with other elements changed the detail on Maple Leaves to black to match the detail on flags and coats of arms at the time which were either black or dark green 22 20 10 singhakhm 25621 000 500 116 kiolibt Great BrightstarRework the shield02 16 15 mithunayn 25621 000 500 189 kiolibt Great BrightstarReduce to 8 fleurs de lis on the red borders lasud du ihmkwa 10 10 hnathimiphaphni mihnathiichiflnimakkwa 100 hna raykartxipniaesdnghnathiichiflni 100 hnaaerkethann miraykaretmkarthingraebidprmanuthihiorchimaaelanangasaki karbukkhrxngnxrmxngdi karprakassngkhram kilabasektbxlinoxlimpikvdurxn thngchatiaekhnada ptibtikarkhbephling ptibtikarmarektkaredn ptibtikaroxewxrlxrd praethskrisinoxlimpikvdurxn 1936 praethschiliinoxlimpikvdurxn 1936 praethsyipuninoxlimpikvdurxn 1936 praethsniwsiaelndinoxlimpikvdurxn 1936 praethsbrasilinoxlimpikvdurxn 1936 praethsblaekeriyinoxlimpikvdurxn 1936 praethsfrngessinoxlimpikvdurxn 1936 praethsfinaelndinoxlimpikvdurxn 1924 praethsfinaelndinoxlimpikvdurxn 1936 praethslichethinchitninoxlimpikvdurxn 1936 praethsxxsetriyinoxlimpikvdurxn 1936 praethsxxsetreliyinoxlimpikvdurxn 1936 praethsxarecntinainoxlimpikvdurxn 1932 praethsxarecntinainoxlimpikvdurxn 1936 praethsxitaliinoxlimpikvdurxn 1936 praethsxinediyinoxlimpikvdurxn 1936 praethsxiyiptinoxlimpikvdurxn 1936 praethshngkariinoxlimpikvdurxn 1936 praethsechoksolwaekiyinoxlimpikvdurxn 1936 praethsednmarkinoxlimpikvdurxn 1936 praethsebleyiyminoxlimpikvdurxn 1936 praethsebxrmiwdainoxlimpikvdurxn 1936 praethsepruinoxlimpikvdurxn 1936 praethsemksiokinoxlimpikvdurxn 1936 praethsaekhnadainoxlimpikvdurxn 1936 praethsopaelndinoxlimpikvdurxn 1936 praethsormaeniyinoxlimpikvdurxn 1936 praethsithyinoxlimpikvdurxn 1952 praethsithyinoxlimpikvdurxn 1956 praethsixsaelndinoxlimpikvdurxn 1936 phunafaysmphnthmitrrahwangsngkhramolkkhrngthisxng faysmphnthmitrinsngkhramolkkhrngthisxng phraecawrwngsethx krmhmunnrathipphngspraphnth yuththkarthiedingaekrk yuththewhathibrietn rthsmachikekhruxckrphphaehngprachachati rangwloneblsakhasrirwithyahruxkaraephthy rachrthlkesmebirkinoxlimpikvdurxn 1936 rachrthomnaokinoxlimpikvdurxn 1936 raykarthnginshrachxanackr raychuxthnginpraethsaekhnada sngkhramekahli smchchaihyaehngshprachachati srupehriyyoxlimpikvdurxn 1924 srupehriyyoxlimpikvdurxn 1928 srupehriyyoxlimpikvdurxn 1932 srupehriyyoxlimpikvdurxn 1936 srupehriyyoxlimpikvdurxn 1948 srupehriyyoxlimpikvdurxn 1952 srupehriyyoxlimpikvdurxn 1956 srupehriyyoxlimpikvduhnaw 1924 srupehriyyoxlimpikvduhnaw 1928 srupehriyyoxlimpikvduhnaw 1932 srupehriyyoxlimpikvduhnaw 1936 srupehriyyoxlimpikvduhnaw 1948 srupehriyyoxlimpikvduhnaw 1952 srupehriyyoxlimpikvduhnaw 1956 shprachachati shrachxanackrinoxlimpikvdurxn 1936 satharnrthkhxstarikainoxlimpikvdurxn 1936 satharnrthcininoxlimpikvdurxn 1936 satharnrthfilippinsinoxlimpikvdurxn 1936 satharnrthmxltainoxlimpikvdurxn 1936 satharnrthltewiyinoxlimpikvdurxn 1936 satharnrthxislamxfkanisthaninoxlimpikvdurxn 1936 satharnrthexsoteniyinoxlimpikvdurxn 1936 satharnrthaexfrikaitinoxlimpikvdurxn 1936 satharnrthokhlxmebiyinoxlimpikvdurxn 1936 satharnrthobliewiyinoxlimpikvdurxn 1936 satharnrthoprtueksinoxlimpikvdurxn 1936 hadoxmaha efredxrik aebnting aenwrbdantawntk sngkhramolkkhrngthisxng aenwrbdantawnxxk sngkhramolkkhrngthisxng okhrngkaraemnaehttn oxlimpikvdurxn 1924 oxlimpikvdurxn 1928 oxlimpikvdurxn 1932 oxlimpikvdurxn 1936 oxlimpikvdurxn 1948 oxlimpikvdurxn 1952 oxlimpikvdurxn 1956 oxlimpikvduhnaw 1924 oxlimpikvduhnaw 1928 oxlimpikvduhnaw 1932 oxlimpikvduhnaw 1936 oxlimpikvduhnaw 1948 oxlimpikvduhnaw 1952 oxlimpikvduhnaw 1956 aemaebb Country data Alberta aemaebb Country data Canada aemaebb Country data Saskatchewan dukarechuxmoyngmayngiflniephimetim karichiflkhamokhrngkar wikixuntxipniichiflni karichbn ace wikipedia org Seunaleuek Country data Kanada karichbn af wikipedia org Olimpiese Somerspele 1924 Newfoundland Tweede Wereldoorlog Sjabloon Inligtingskas Militere konflik Sjabloon Landdata Kanada Geallieerdes van die Tweede Wereldoorlog Japannese nasionale rugbyspan Slag van Normandie Olimpiese Somerspele 1944 Olimpiese Somerspele 1956 Olimpiese Somerspele 1952 Olimpiese Somerspele 1948 Olimpiese Somerspele 1928 Olimpiese Somerspele 1932 Olimpiese Somerspele 1936 Olimpiese Winterspele 1956 Olimpiese Winterspele 1952 Olimpiese Winterspele 1948 Olimpiese Winterspele 1944 Olimpiese Winterspele 1936 Olimpiese Winterspele 1932 Olimpiese Winterspele 1928 Olimpiese Winterspele 1924 Vlag van Kanada Kanadese nasionale rugbyspan Nobelprys vir Fisiologie of Geneeskunde Korea oorlog Slag van Okinawa Slag van Noord Kaap Statebondspele Vlag van die Verenigde Koninkryk Operasie Totalize Slag om Brittanje Boeing B 17 Flying Fortress Sherman Firefly Sjabloon Inligtingskas Militere konflik doc karichbn am wikipedia org የኮርያ ጦርነት 2ኛው ዓለማዊ ጦርነት የሩሶ ዩክሬን ቀውስ karichbn ang wikipedia org Bysen Country data Caenada Bysen Country data Canada karichbn an wikipedia org Batalla de Normandia 10 km marcha en os Chuegos Olimpicos de Paris 1924 Baloncesto en os Chuegos Olimpicos Avro Lancaster karichbn ar wikipedia org قرار تقسيم فلسطين الحرب العالمية الثانية عصبة الأمم المنظمة العالمية للحركة الكشفية dukarichkhamokhrngkarephimetimkhxngiflnikhxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnnkhwamkwang100 khwamsung100