ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkar khxmulekiywkbphaphkhnadkhxngtwxyangni 749 599 phikesl khwamlaexiydxun 300 240 phikesl 600 480 phikesl 960 768 phikesl 1 280 1 024 phikesl 2 560 2 048 phikesl 3 371 2 697 phikesl duphaphthimikhwamlaexiydsungkwa 3 371 2 697 phikesl khnadifl 6 29 emkaibt chnidimm image jpeg rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid khwamyx silpin phusrangsrrkhngan Unknown artistUnknown artistkhaxthibay English A bearded man having anal sex with a beardless youth side A of the so called Warren Cup Roman artwork Deutsch Ein bartiger Mann im Geschlechtsakt mit einem Jungen Warren Cup Espanol Un hombre con barba haciendo el amor con un joven imberbe lado A de la llamada Copa de Warren Artesania romana Francais Homme barbu sodomisant un jeune homme glabre face A de la Coupe Warren Art romain Islenska Madur med skegg ad njota astar med skegglausum unglingi hlid A af svo kolludum Warren Romversk list Portugues Um homem com barba fazendo sexo anal com um jovem imberbe lado A da chamada Warren Cup Artesanato Romano wnthi mid 1 century AD date QS P571 050 00 00T00 00 00Z 7suxthiephyaephr silvermedium QS P186 Q1090khnad H 11 cm 4 in Diam 9 cm 3 in karekbrwbrwm phiphithphnthbritich chuxinphasatnchbb British Museumthitng lxndxnphikd 51 31 10 ehnux 0 07 37 tawntk cdtngkhunemux 2295 hrux 2296ewbist www britishmuseum orgngankhwbkhumraykarhlkthan Q6373 VIAF 134857252 ISNI 0000000123428817 ULAN 500125180 OSM 177044 Open Library OL52264A WorldCat institution QS P195 Q6373taaehnngthixyu Upper floor room 70rhskarthuxkhrxng GR 1999 4 26 1 Cat Sculptures 628 prawtikhxngwtthuni English Said to be from Bittir ancient Bethther near Jerusalem Espanol Se cree que procede de Bittir antigua Bethther cerca de Jerusalen Francais Proviendrait de Bittir ancienne Bethther pres de Jerusalem Islenska Sagt vera komid af Bittir forn Bethther nalaegt Jerusalem karekhathuxkhrxng Purchased with the aid of several members of the Greek and Roman Department s international group of supporters the Caryatids and the support of the Heritage Lottery Fund the National Art Collections Fund and The British Museum Friendsthima phuthayphaph Marie Lan Nguyen 2011 karxnuyat karichiflniihm Object Public domain Public domain false falsenganniepnsatharnsmbti inpraethstnkaenidaelapraethsxun thirayaewlakarkhumkhrxnglikhsiththinxykwa 100 pihlngcakphusrangsrrkhnganesiychiwit nxkcaknikhunxactxngephimpaysatharnsmbtiinshrthxemrika ephuxrabuwaehtuidngannicungepnsatharnsmbtiinshrthxemrikaiflniidthukrabuwaimmikhxcakdphayitkdhmaylikhsiththi rwmthungsiththithiekiywkhxngaelathiiklekhiyngknhttps creativecommons org publicdomain mark 1 0 PDM Creative Commons Public Domain Mark 1 0 false false phaphthay iflnixyuphayitsyyaxnuyatkhriexthifkhxmmxns runaesdngthima 2 5 thwipkhunsamarth thicaaebngpn thicathasaena aeckcay aelasngngandngklawtxip thicaeriyberiyngihm thicaddaeplngngandngklaw phayitenguxnikhtxipni aesdngthima khuntxngihekiyrtiecakhxngnganxyangehmaasm odyephimlingkipyngsyyaxnuyat aelarabuhakmikarepliynaeplng khunxacthaechnniidinrupaebbidkidtamkhwr aettxngimichinlksnathiaenawaphuihxnuyatsnbsnunkhunhruxkarichngankhxngkhunhttps creativecommons org licenses by 2 5 CC BY 2 5 Creative Commons Attribution 2 5 true truekhabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixairxitaliUn uomo e un giovinetto dell antica Roma tazza d argento con immagine in rilievo I secolo d C ritrovata in Bittir Palestina ixethmthiaesdngxyuiniflniprakxbdwynaked man xngkvsWarren Cup xngkvssthanalikhsiththimilikhsiththisyyaxnuyatCreative Commons Attribution 2 5 Generic xngkvsbnthukphaphdwyNikon D300S xngkvs prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann wnthi ewlarupyxkhnadphuichkhwamehnpccubn19 47 20 phvsphakhm 25543 371 2 697 6 29 emkaibt Jastrowlarger resolution more depth of field00 54 8 singhakhm 25502 800 2 545 3 54 emkaibt Jastrow Summary Information British Museum artist Unknown description en A bearded man making love with a beardless youth side A of the so called Warren Cup Silver Roman artwork middle of the 1st century AD Said to be from Bittir ancient Be hnathimiphaphni hnatxipni oyngmathiphaphni epedrstis karichiflkhamokhrngkar wikixuntxipniichiflni karichbn af wikipedia org Warren beker Seksposisie karichbn ar wikipedia org المثلية الجنسية في روما القديمة تاريخ العالم في 100 قطعة أثرية karichbn as wikipedia org ক শ ৰ প ৰ ত karichbn az wikipedia org Vorren qedehi karichbn be wikipedia org Kubak Uorena karichbn bn wikipedia org ব লকপ র ত সমক ম ত র ইত হ স karichbn bo wikipedia org བཤང ས འ ཆགས ས ར མཚན མཐ ན དགའ ར གས ས ག པ karichbn ca wikipedia org Imperi Roma Homosexualitat Antiga Roma Pederastia Cultura de l antiga Roma Drets LGBT a Europa Homosexualitat a l antiga Roma Copa Warren karichbn de wikipedia org Portal Diskussion Homo und Bisexualitat Archiv 2007 Q4 A History of the World in 100 Objects karichbn el wikipedia org Pylh LOAT Epilegmenh eikona 10 Kylikas Goyoren karichbn eml wikipedia org La storia del mondo in 100 oggetti karichbn en wikipedia org Anal sex History of homosexuality Warren Cup Edward Perry Warren Homosexuality in ancient Rome User talk Benjiboi Archive 3 User Gabe Friedman A History of the World in 100 Objects User SocialHaze Sandbox Homosexuality karichbn es wikipedia org Homosexualidad Antigua Roma Diversidad sexual en Europa Edward Perry Warren Homosexualidad en la Antigua Roma Copa Warren Una historia del mundo en cien objetos karichbn et wikipedia org Homoseksuaalsus Vana Kreekas Kasutaja Kati Keha Anaalseks karichbn eu wikipedia org Homosexualitatea Antzinate Klasikoan karichbn fa wikipedia org آمیزش جنسی مقعدی جام وارن karichbn fr wikipedia org Homosexualite dans l Antiquite Coupe Warren Une histoire du monde en cent objets Edward Perry Warren Homosexualite dans la Rome antique dukarichkhamokhrngkarephimetimkhxngiflnikhxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnnphuphlitklxngNIKON CORPORATIONrunkhxngklxngNIKON D300SphuthayMarie Lan NguyenphuthrnglikhsiththiCreative Commons Attributionewlaepidhnaklxng1 5 winathi 0 2 khaexff 13xtrakhwamerw ISO1 000ewlathibnthukphaph16 37 15 phvsphakhm 2554khwamyawofkselns46 mm karcdwangphaphpktikhwamlaexiydaenwnxn300 dpikhwamlaexiydaenwtng300 dpisxftaewrthiichGIMP 2 6 11aekikhphaphlasud14 19 20 phvsphakhm 2554opraekrmexksophechxrtngkhaexngrunexksif Exif 2 1ewlathiaeplngepndicithl16 37 15 phvsphakhm 2554khwamerwchtetxr2 321928kharurbaesng A 7 40088karchdechyaesng0rurbaesngkwangsud3 APEX f 2 83 rayawtthu0 25 emtrohmdkarwdaesngspxtaesngimthrabaeflchimichaeflchesiywwinathi wnthi ewla74esiywwinathi wnthi ewlatnchbb74esiywwinathi wnthi ewlathidiciiths74runaeflchphiksthirxngrb1sepssisRGBwithikarwdesnesxrcudediywtnchbbiflklxngthayphaphningdicithlchnidsinphaphthayodytrngkarpramwlphaphophlessspktiohmdexksophechxrexksophechxrtngkhaexngiwtbalansiwtbalanstngkhaexngdicithlsum1rayaofksinfilm 35 mm 69 mm chnidsinaekhpecxrpktisinkhxnothrlekn sung khunkhwamepribbtangpktikhwamximsipktikhwamkhmpktirayahangwtthuimthrabrunciphiexsaethk2 2 0 0