ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkar khxmulekiywkbphaphkhnadkhxngtwxyangni 472 600 phikesl khwamlaexiydxun 189 240 phikesl 378 480 phikesl 604 768 phikesl 806 1 024 phikesl 1 612 2 048 phikesl 2 660 3 380 phikesl duphaphthimikhwamlaexiydsungkwa 2 660 3 380 phikesl khnadifl 2 35 emkaibt chnidimm image jpeg rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid khaxthibayVirtual Boy Set jpg English A North American Virtual Boy game console made by Nintendo A system that let you see in 3 D by use of individual red and black LCD screens for each eye The system was a commercial failure for Nintendo wnthi 22 knyayn ph s 2554aehlngthima ngankhxngtwphusrangsrrkh Evan Amoskarxnuyat karichiflniihm iflnixyuphayitsyyaxnuyat khriexthifkhxmmxns aebbaesdngthima xnuyataebbediywkn 3 0 tnchbbkhunsamarth thicaaebngpn thicathasaena aeckcay aelasngngandngklawtxip thicaeriyberiyngihm thicaddaeplngngandngklaw phayitenguxnikhtxipni aesdngthima khuntxngihekiyrtiecakhxngnganxyangehmaasm odyephimlingkipyngsyyaxnuyat aelarabuhakmikarepliynaeplng khunxacthaechnniidinrupaebbidkidtamkhwr aettxngimichinlksnathiaenawaphuihxnuyatsnbsnunkhunhruxkarichngankhxngkhun xnuyataebbediywkn hakkhunddaeplng epliynrup hruxtxetimnganni khuntxngichsyyaxnuyataebbediywknhruxaebbthiehmuxnkbsyyaxnuyatthiichkbnganniethannhttps creativecommons org licenses by sa 3 0 CC BY SA 3 0 Creative Commons Attribution Share Alike 3 0 true trueewxrchnxun Transparent PNG version Photo by Evan AmosAbout English This photo was taken by Evan Amos as a part of Vanamo Media which creates public domain works for educational purposes Please visit my other galleries and projects for other free media Personal Pages Vanamo Online Game Museum About Me Credits Wikipedia Talk Page Commons Talk Page InterviewsImage Galleries Candy Food People Everyday Video Games My FlickrProvided By Video Games New YorkSpecial thanks to retro and import video game store Video Games New York in Manhattan for providing the item above to be photographed for Wikipedia Taken With Sony A700This photo was taken by Evan Amos with a Sony Alpha A700 DSLR using a 70 210mm F 4 or 50mm F 1 7 Minolta lens khabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixairxngkvsNorth American Virtual BoyrsesiySevero Amerikanskij dizajn Virtual Boy ixethmthiaesdngxyuiniflniprakxbdwyphusrangbangkhathiimmiixethmwikisnethschuxphuichwikimiediy Evan Amosyuxaraexl https commons wikimedia org wiki user Evan Amoschuxphusrangsrrkh Evan AmossthanalikhsiththimilikhsiththisyyaxnuyatCreative Commons Attribution ShareAlike 3 0 Unported xngkvsbnthukphaphdwySony Alpha 700 xngkvswnthisrang wnkxtng22 knyayn 2011thimakhxngiflkarsrangdngedimodyphuxpohld prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann wnthi ewlarupyxkhnadphuichkhwamehnpccubn01 03 19 emsayn 25552 660 3 380 2 35 emkaibt Information Description en 1 A North American Virtual Boy game console made by Nintendo A system that let you see in 3 D by use of individual red and black LCD screens for each eye The system was a commercial failure for Nintendo Source hnathimiphaphni hnatxipni oyngmathiphaphni ewxrchwlbxy karichiflkhamokhrngkar wikixuntxipniichiflni karichbn ar wikipedia org نينتندو للبحث والتطوير 1 فيرتشوال بوي karichbn cs wikipedia org Nintendo Virtual Boy karichbn de wikipedia org Nintendo karichbn en wikipedia org Nintendo Virtual Boy Gunpei Yokoi Fifth generation of video game consoles List of Virtual Boy games History of video game consoles Jack Bros Nintendo Research amp Development 1 Nintendo video game consoles 1990s in video games karichbn en wikibooks org History of video games Platforms Virtual Boy History of video games Print version Fifth Generation of Video Game Consoles karichbn es wikipedia org Videoconsolas de quinta generacion karichbn eu wikipedia org Lankide 81 9 192 132 Proba orria Lankide Uduran08 Proba orria karichbn fr wikipedia org Gunpei Yokoi Utilisateur Odjob16 karichbn hu wikipedia org Otodik generacios videojatek konzolok karichbn ka wikipedia org მეხუთე თაობის ვიდეო თამაშების კონსოლები Virtual Boy karichbn ko wikipedia org 5세대 비디오 게임기 karichbn nl wikipedia org Virtual Boy Gunpei Yokoi karichbn pt wikipedia org Consoles de jogos eletronicos de quinta geracao karichbn ru wikipedia org Nintendo Pyatoe pokolenie igrovyh sistem karichbn simple wikipedia org Virtual Boy History of video game consoles fifth generation List of Virtual Boy games karichbn sq wikipedia org Konzolat e lojerave video Nintendo karichbn tr wikipedia org Virtual Boy karichbn uk wikipedia org P yate pokolinnya igrovih sistem karichbn vi wikipedia org Virtual Boy Yokoi Gunpei karichbn zh wikipedia org 第五世代遊戲機 任天堂電子遊戲機列表khxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnnchuxphaphSONY DSCphuphlitklxngSONYrunkhxngklxngDSLR A700ewlaepidhnaklxng1 200 winathi 0 005 khaexff 18xtrakhwamerw ISO100ewlathibnthukphaph00 43 22 knyayn 2554khwamyawofkselns75 mm karcdwangphaphpktikhwamlaexiydaenwnxn240 dpikhwamlaexiydaenwtng240 dpisxftaewrthiichAdobe Photoshop CS5 Windowsaekikhphaphlasud13 57 18 emsayn 2555opraekrmexksophechxrtngkhaexngrunexksif Exif 2 21ewlathiaeplngepndicithl00 43 22 knyayn 2554khwamerwchtetxr7 643856kharurbaesng A 8 33985khwamswang APEX1 75karchdechyaesng0rurbaesngkwangsud4 APEX f 4 ohmdkarwdaesngaephtethirnaesngaeflchaeflchimichaeflch rangbichaeflchsepssiimidprbethiybtnchbbiflklxngthayphaphningdicithlchnidsinphaphthayodytrngkarpramwlphaphophlessspktiohmdexksophechxrexksophechxrtngkhaexngiwtbalansiwtbalanstngkhaexngdicithlsum0rayaofksinfilm 35 mm 112 mm chnidsinaekhpecxrpktikhwamepribbtangpktikhwamximsikhwamekhmsisungkhwamkhmpktielnsthiich70 210mm F4karihkhaaenn cak 5 0wnthiaekikhkhxmulemtalasud09 57 18 emsayn 2555ID echphaakhxngexksartnchbbC103ADA8D7BD346E9E223F317D8EA0BBrun IIM33 276