ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkar khxmulekiywkbphaphkhnadkhxngtwxyangni 800 571 phikesl khwamlaexiydxun 320 229 phikesl 640 457 phikesl 1 024 731 phikesl 1 280 914 phikesl 2 100 1 500 phikesl duphaphthimikhwamlaexiydsungkwa 2 100 1 500 phikesl khnadifl 384 kiolibt chnidimm image jpeg rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid Ddggyedfbhy khwamyx khaxthibayUS Navy 050102 N 9593M 040 A village near the coast of Sumatra lays in ruin after the Tsunami that struck South East Asia jpg Bahasa Indonesia Samudera Hindia 2 Januari 2005 Sebuah desa di dekat pantai Sumatera mengalami kehancuran setelah tsunami yang melanda Asia Tenggara Helikopter ditugaskan dalam misi Carrier Air Wing Two CVW 2 dan pelaut dari USS Abraham Lincoln CVN 72 sedang melakukan operasi kemanusiaan pasca Tsunami yang melanda Asia Tenggara Kelompok Abraham Lincoln Carrier Strike Group saat itu beroperasi di Samudera Hindia di perairan Indonesia dan Thailand Foto Angkatan Laut AS oleh Fotografer Mate Kelas 2 Philip A McDaniel Diterbitkan English Indian Ocean Jan 2 2005 A village near the coast of Sumatra lies in ruins after the Tsunami that struck South East Asia Helicopters assigned to Carrier Air Wing Two CVW 2 and Sailors from USS Abraham Lincoln CVN 72 are conducting humanitarian operations in the wake of the Tsunami that struck South East Asia The Abraham Lincoln Carrier Strike Group is currently operating in the Indian Ocean off the waters of Indonesia and Thailand South West suburb of Banda Aceh Indonesia Village of Lampisang is visible in the upper right corner U S Navy photo by Photographer s Mate 2nd Class Philip A McDaniel RELEASED wnthi Taken on 2 mkrakhm ph s 2548aehlngthima This image was released by the United States Navy with the ID 050102 N 9593M 040 next This tag does not indicate the copyright status of the attached work A normal copyright tag is still required See Commons Licensing العربية ব ল Deutsch Deutsch Sie Form English espanol euskara فارسی francais italiano 日本語 한국어 makedonski മലയ ള Plattduutsch Nederlands polski پښتو portugues russkij slovenscina svenska Turkce ukrayinska 简体中文 繁體中文 phusrangsrrkh U S Navy photo by Photographer s Mate 2nd Class Philip A McDaniel karxnuyatichsiththi Public domain Public domain false falseiflniepnphlngankhxngthhareruxhruxecahnathikhxngkxngthpheruxshrth sungidthayphaphhruxthakhun ephuxepnswnhnungkhxnghnathiinrachkarkhxngbukhkhlnn inthanangankhxngrthbalklangshrth phaphnicungthuxepnsatharnsmbtiinshrthxemrika iflniidthukrabuwaimmikhxcakdphayitkdhmaylikhsiththi rwmthungsiththithiekiywkhxngaelathiiklekhiyngkn https creativecommons org publicdomain mark 1 0 PDM Creative Commons Public Domain Mark 1 0 false falseThis file was reviewed on 8 singhakhm ph s 2553 by the administrator or trusted user Rlevse Talk who confirmed the Public Domain status on that date khabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixairxngkvsAftermath of the 2004 Indian Ocean Tsunami in Banda AcehoprtueksA village near Sumatra after Tsunami hindiब द म 2004 म ह द मह स गर म स न म क ब दixethmthiaesdngxyuiniflniprakxbdwykhlunsunamibndaxaecahmhasmuthrxinediywnthisrang wnkxtng2 mkrakhm 2005bnthukphaphdwyNikon D2H xngkvsexposure time xngkvs0 0025 winathif number xngkvs5 6focal length xngkvs24 milliemtrISO speed xngkvs200media type xngkvsimage jpegepnphaphthay prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann wnthi ewlarupyxkhnadphuichkhwamehnpccubn04 37 24 tulakhm 25522 100 1 500 384 kiolibt BotMultichillT int filedesc Information description en 1 Indian Ocean Jan 2 2005 A village near the coast of Sumatra lays in ruin after the Tsunami that struck South East Asia Helicopters assigned to Carrier Air Wing Two CVW 2 and Sailors f hnathimiphaphni hnatxipni oyngmathiphaphni aephndinihwaelakhlunsunamiinmhasmuthrxinediy ph s 2547 karichiflkhamokhrngkar wikixuntxipniichiflni karichbn ace wikipedia org Ie beuna karichbn ar wikipedia org صحافة مصورة بوابة كوارث مقالة مختارة 2 karichbn ast wikipedia org Terremotu del oceanu Indicu de 2004 karichbn ba wikipedia org Һind okeanynda er tetrәүe 2004 karichbn bcl wikipedia org Aceh karichbn bg wikipedia org Zemetresenie v Indijskiya okean 26 dekemvri 2004 karichbn bn wikipedia org ২০০৪ এর ভ রত মহ স গর ভ ম কম প ও স ন ম karichbn ca wikipedia org Tsunami de l ocea Indic del 2004 Aceh The Impossible karichbn cs wikipedia org 26 prosinec Zemetreseni v Indickem oceanu 2004 Aceh Seznam zivelnich katastrof podle poctu obeti karichbn da wikipedia org Jordskaelvet i Det Indiske Ocean 2004 Chokdoktrinen karichbn de wikipedia org Erdbeben im Indischen Ozean 2004 Liste von Katastrophen karichbn el wikipedia org Seismos kai tsoynami toy Indikoy Wkeanoy 2004 Fysikos kindynos karichbn en wikipedia org Aceh Survivalism 2004 Indian Ocean earthquake and tsunami Countries affected by the 2004 Indian Ocean earthquake and tsunami Effect of the 2004 Indian Ocean earthquake on Indonesia Portal India Today s selected article July 2006 Portal India Today s selected article September 2006 Portal India Today s selected article November 2006 Portal India Today s selected article July 22 2006 Portal India Today s selected article September 24 2006 Portal India Today s selected article November 23 2006 Portal India SC Summary SA 2004 Indian Ocean earthquake Portal India Today s selected article January 2007 Portal India Today s selected article January 22 2007 Portal India Selected articles Archive Portal Indonesia Featured picture 2010 Portal Indonesia POTW 51 2010 The Impossible 2012 film Coastal flooding User SushiGod sandbox kivu karichbn en wikinews org Tsunami death toll updated karichbn en wikiversity org Motivation and emotion Book 2023 Tragic optimism karichbn eo wikipedia org Tertremo en Hinda Oceano en 2004 karichbn es wikipedia org Periodismo fotografico Tsunami Anos 2000 Terremoto del oceano Indico de 2004 Preparacionismo Lo imposible dukarichkhamokhrngkarephimetimkhxngiflnikhxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnnphuphlitklxngNIKON CORPORATIONrunkhxngklxngNIKON D2HphuthayPH2 AW SW PJ Philip A McDanielewlaepidhnaklxng1 400 winathi 0 0025 khaexff 5 6xtrakhwamerw ISO200ewlathibnthukphaph01 29 2 mkrakhm 2548khwamyawofkselns24 mm ekhrdit phucdetriymU S NavytnchbbNavy Visual News Servicechuxeruxngsn050102 N 9593M 040chuxphaph050102 N 9593M 040Indian Ocean Jan 2 2005 A village near the coast of Sumatra lays in ruin after the Tsunami that struck South East Asia Helicopters assigned to Carrier Air Wing Two CVW 2 and Sailors from USS Abraham Lincoln CVN 72 are conducting humanitarian operations in the wake of the Tsunami that struck South East Asia The Abraham Lincoln Carrier Strike Group is currently operating in the Indian Ocean off the waters of Indonesia and Thailand U S Navy photo by Photographer s Mate 2nd Class Philip A McDaniel RELEASED karcdwangphaphpktikhwamlaexiydaenwnxn300 dpikhwamlaexiydaenwtng300 dpisxftaewrthiichAdobe Photoshop CS Macintoshaekikhphaphlasud12 33 2 mkrakhm 2548iwtphxytokhrmatik0 313 0 329okhrmatikkhxngiphrmariti0 64 0 33 0 21 0 71 0 15 0 06smprasiththiemthrikskarepliynaeplngkhxngsepssi0 299 0 587 0 114taaehnng Y aela CCo sitedopraekrmexksophechxrtngkhaexngrunexksif Exif 2 21ewlathiaeplngepndicithl01 29 2 mkrakhm 2548khwamhmaykhxngaetlakhxmophenntY Cb Cr immikhaohmdkarbibxdphaph2karchdechyaesng0rurbaesngkwangsud3 6 APEX f 3 48 ohmdkarwdaesngaephtethirnaesngimthrabaeflchimichaeflchesiywwinathi wnthi ewla81esiywwinathi wnthi ewlatnchbb81esiywwinathi wnthi ewlathidiciiths81runaeflchphiksthirxngrb1sepssiimidprbethiybwithikarwdesnesxrcudediywtnchbbiflklxngthayphaphningdicithlchnidsinphaphthayodytrngkarpramwlphaphophlessspktiohmdexksophechxrexksophechxrtngkhaexngiwtbalansiwtbalansxtonmtidicithlsum1rayaofksinfilm 35 mm 36 mm chnidsinaekhpecxrpktisinkhxnothrlimmikhwamepribbtangpktikhwamximsipktikhwamkhmpktirayahangwtthuimthrabrunaeflchphiksthirxngrb1khwamkwangkhxngphaph2 100 phikeslkhwamsungkhxngphaph1 500 phikeslphuekhiynDep Dir NVNSkhaaenanaphiessCredit as U S Navy photo by Philip A McDanielhmwdhmuNhmwdhmuesrim 703 614 9154 navyvisualnews navy mil UNCLASSIFIEDwnthiaekikhkhxmulemtalasud07 33 2 mkrakhm 2548khasakhyAcehm Sumatra Indonesia helicopter seahawk sh 60b lincoln cvn 72 cvn 72 people aircrew saberhawks golden falcon hsl 47 hsl 47 hs 2 hs 2 golden falcons aerial damage aid relief humanitarian airlifts thailand tsunami food suppliesrun IIM2