ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkar khxmulekiywkbphaphkhnadkhxngtwxyangni 800 538 phikesl khwamlaexiydxun 320 215 phikesl 640 430 phikesl 1 024 688 phikesl 1 280 860 phikesl 2 560 1 720 phikesl 3 174 2 133 phikesl duphaphthimikhwamlaexiydsungkwa 3 174 2 133 phikesl khnadifl 6 18 emkaibt chnidimm image jpeg rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid khwamyx khaxthibayTea house in Moscow JPG Tea house in Moscowwnthi 24 mithunayn ph s 2560 18 05aehlngthima Tea housephusrangsrrkh svklimkin from Moscow Russiankarxnuyat karichiflniihm Public domain Public domain false falseThis work has been released into the public domain by the author on Flickr where the author has declared it as a Public Domain Work and tagged it with the Creative Commons Public Domain Mark The Public Domain Mark PDM is not a copyright license but a symbol used to indicate that a work is in the public domain When it is applied by the author or the copyright holder community consensus has decided such works as being public domain in the US and countries where it is legally possible to release own work to the public domain In the countries where this is not possible the copyright status of the work remains undetermined If a file is tagged with Public Domain Mark by someone other than the author or the copyright holder a more specific copyright tag such as one found at Commons Copyright tags General public domain must be applied If this is your own work please use Cc zero instead Public domain Public domain false false taaehnngthitngklxng55 45 51 21 ehnux 37 38 09 85 tawnxxk phaphniaelaphaphxun n sthanthiediywknthi OpenStreetMap55 764225 37 636070karxnuyatichsiththi This image was originally posted to Flickr by svklimkin at https flickr com photos 152442938 N03 35820351235 It was reviewed on 5 thnwakhm ph s 2563 by FlickreviewR 2 and was confirmed to be licensed under the terms of the Public Domain Mark 5 thnwakhm ph s 2563khabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixairxngkvsTea house in Moscow 2017ixethmthiaesdngxyuiniflniprakxbdwysthanalikhsiththicopyrighted dedicated to the public domain by copyright holder xngkvssatharnsmbtisyyaxnuyatreleased into the public domain by the copyright holder xngkvswnthisrang wnkxtng24 mithunayn 2017coordinates of the point of view xngkvs55 45 51 210 N 37 38 9 852 EbnthukphaphdwyCanon EOS 5D Mark IV xngkvsexposure time xngkvs0 004 winathif number xngkvs4focal length xngkvs24 milliemtrISO speed xngkvs100epnphaphthaythimakhxngiflfile available on the internet xngkvsphudaeninkar flikhekxrxthibayin URL https www flickr com photos svklimkin 35820351235media type xngkvsimage jpegchecksum xngkvsb41adc636c8d95a9d4fa1ee54c3a16a331064746withikarkahnd SHA 1 xngkvsdata size xngkvs6 477 893 ibtkhwamsung2 133 phikeslkhwamkwang3 174 phikesl prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann wnthi ewlarupyxkhnadphuichkhwamehnpccubn01 47 6 thnwakhm 25633 174 2 133 6 18 emkaibt TillmanTransferred from Flickr via flickr2commons hnathimiphaphni hnatxipni oyngmathiphaphni orngnacha karichiflkhamokhrngkar wikixuntxipniichiflni karichbn en wikipedia org Teahouse karichbn en wiktionary org herbaciarnia karichbn hy wikipedia org Մասնակից Քրիստինե Կոբիլինա Ավազարկղ1 Թեյարան karichbn ja wikipedia org ティーハウス karichbn mk wikipedia org Chaјџilnicakhxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnnphuphlitklxngCanonrunkhxngklxngCanon EOS 5D Mark IVphuthaySVKLIMKINphuthrnglikhsiththiSVKLIMKINewlaepidhnaklxng1 250 winathi 0 004 khaexff 4xtrakhwamerw ISO100ewlathibnthukphaph18 05 24 mithunayn 2560khwamyawofkselns24 mm khwamlaexiydaenwnxn240 dpikhwamlaexiydaenwtng240 dpisxftaewrthiichAdobe Photoshop Lightroom 6 10 1 Windows aekikhphaphlasud17 45 26 mithunayn 2560opraekrmexksophechxrkahndrurbaesngepnhlk a runexksif Exif 2 3ewlathiaeplngepndicithl18 05 24 mithunayn 2560khwamerwchtetxr7 965784kharurbaesng A 4karchdechyaesng0rurbaesngkwangsud4 APEX f 4 ohmdkarwdaesngaephtethirnaeflchimichaeflch rangbichaeflchesiywwinathi wnthi ewlatnchbb00esiywwinathi wnthi ewlathidiciiths00sepssisRGBkhwamlaexiydranabofks X5 719 1489361702khwamlaexiydranabofks Y5 728 9002557545hnwykhwamlaexiydranabofksniwkarpramwlphaphophlessspktiohmdexksophechxrexksophechxrxtonmtiiwtbalansiwtbalansxtonmtichnidsinaekhpecxrpktirhsphaph8E972FD169F1DC90402E21B171E18F25hmayelkhsieriylkhxngklxng033022007348elnsthiichEF24 105mm f 4L IS USMwnthiaekikhkhxmulemtalasud20 42 26 mithunayn 2560ID echphaakhxngexksartnchbb1950BE7181C3D1217A519818211AB3FErun IIM4