ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkar khxmulekiywkbphaphkhnadkhxngtwxyangni 800 400 phikesl khwamlaexiydxun 320 160 phikesl 640 320 phikesl 1 024 512 phikesl 1 280 640 phikesl 2 560 1 280 phikesl 4 240 2 120 phikesl duphaphthimikhwamlaexiydsungkwa 4 240 2 120 phikesl khnadifl 1 88 emkaibt chnidimm image jpeg rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid nikhuxphaphkhdsrrinwikiphiediyphasaxngkvs Featured pictures aela khux thuxwaepn phaphxyangidxyanghnungthidithisud thakhidwaiflnikhwrcaihkhwamsakhykbwikimiediykhxmmxnsepnxyangdi xyalngelthica esnxchux hakkhunmiphaphthimikhunphaph khlaykhlungkn thicasamarthephyaephridtam syyaxnuyatthiehmaasm ihaenicwa khunid xpohld kahndsyyaxnuyat aelaid esnxchuxaelw khwamyx khaxthibaySega Mega Drive JP Mk1 Console Set jpg English The Japanese Sega Mega Drive video game console This is the first design model of the system Espanol La version japonesa de la videoconsola Sega Mega Drive Este es el primer diseno del sistema Ukrayinska Yaponska gralna konsol Sega Mega Drive Ce persha model konsoli wnthi 10 tulakhm ph s 2554aehlngthima ngankhxngtwphusrangsrrkh Evan Amoskarxnuyat karichiflniihm Public domain Public domain false falsekhapheca phuthuxlikhsiththiinnganni khxmxbnganihepnsatharnsmbti prakasnimiphlthwolk inbangpraeths karkrathadngklawxacimsamarththaidtamkdhmay khaphecaxnuyatihthukkhnmisiththiinkarichiflniinthukehtuphlkarich odyimmimienguxnikh ewnaetkdhmayimxnuyatihthaechnnnewxrchnxun Transparent PNG version Photo by Evan AmosAbout English This photo was taken by Evan Amos as a part of Vanamo Media which creates public domain works for educational purposes Please visit my other galleries and projects for other free media Personal Pages Vanamo Online Game Museum About Me Credits Wikipedia Talk Page Commons Talk Page InterviewsImage Galleries Candy Food People Everyday Video Games My FlickrProvided By Video Games New YorkSpecial thanks to retro and import video game store Video Games New York in Manhattan for providing the item above to be photographed for Wikipedia Taken With Sony A700This photo was taken by Evan Amos with a Sony Alpha A700 DSLR using a 70 210mm F 4 or 50mm F 1 7 Minolta lens khabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixairxngkvsThe Sega Mega Drive consolesepnEl primer diseno de la consola japonesa Sega Mega Drive rsesiyIgrovaya konsol Sega Mega Drive ixethmthiaesdngxyuiniflniprakxbdwyeska emkaidrfphusrangbangkhathiimmiixethmwikisnethsyuxaraexl https commons wikimedia org wiki user Evan Amoschuxphusrangsrrkh Evan Amoschuxphuichwikimiediy Evan Amossthanalikhsiththicopyrighted dedicated to the public domain by copyright holder xngkvsmilikhsiththisyyaxnuyatreleased into the public domain by the copyright holder xngkvswnthisrang wnkxtng10 tulakhm 2011bnthukphaphdwySony Alpha 700 xngkvsthimakhxngiflkarsrangdngedimodyphuxpohldmedia type xngkvsimage jpegexposure time xngkvs0 005 winathif number xngkvs16focal length xngkvs75 milliemtrISO speed xngkvs100epnphaphthay prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann wnthi ewlarupyxkhnadphuichkhwamehnpccubn10 16 18 minakhm 25574 240 2 120 1 88 emkaibt Crisco 1492Remove shadow behind console23 09 9 phvscikayn 25544 240 2 120 1 97 emkaibt Information Description en 1 The Japanese Sega Mega Drive video game console This is the first design model of the system Source own Author Date 2011 10 10 Permission o hnathimiphaphni hnatxipni oyngmathiphaphni eska emkaidrf karichiflkhamokhrngkar wikixuntxipniichiflni karichbn arz wikipedia org سيجا جينسيس توب جير 2 ذا سكاند ساموراى اوسوماتسو كون هاشاميشا جيكيجو اليكس كيدز ان ذا انشنتيد كاسل ستريتس اوف راج ستريتس اوف راج 3 ذا ريڤينج اوف شينوبى ستريتس اوف راج 2 شينوبى 3 ريتيرن اوف ذا نينچا ماستر التيريد بايست ستريت سمارت لاست باتل فيديو لعب 1989 پرو موڤز سوكر karichbn de wikipedia org Sega Oktober 1988 Benutzer Torben Friedrich Liste der Exponate im Museum Hi Score karichbn en wikipedia org 1980s Treasure company Fourth generation of video game consoles Wikipedia Lamest edit wars History of video game consoles Gunstar Heroes 1988 in video games Sega Genesis Alien Soldier Wikipedia Lamest edit wars Names Wikipedia WikiProject Video games Sega Images Verytex Wikipedia Featured pictures Engineering and technology Electronics List of Sega video game consoles User talk Evan Amos User talk Evan Amos Wiki Notice Wikipedia talk Featured and good topic questions Archive 6 Wikipedia WikiProject Video games Recognized content Wikipedia talk WikiProject Video games Archive 102 Wikipedia Featured pictures thumbs 40 Wikipedia Featured picture candidates March 2014 Wikipedia Featured picture candidates Sega Genesis User talk Crisco 1492 Archive 48 Twinkle Tale Portal Video games Recognized content Seirei Senshi Spriggan karichbn en wikibooks org History of video games Platforms Sega Genesis History of video games Print version Fourth Generation of Video Game Consoles 68000 Assembly Who used the 68k series Emulation Mega Drive 68000 Assembly Printable version Mega Man classic series Spin off Games karichbn en wikiversity org Digital Media Concepts Evolution of Bits in Game Graphics dukarichkhamokhrngkarephimetimkhxngiflnikhxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnnchuxphaphSONY DSCphuphlitklxngSONYrunkhxngklxngDSLR A700ewlaepidhnaklxng1 200 winathi 0 005 khaexff 16xtrakhwamerw ISO100ewlathibnthukphaph01 54 10 tulakhm 2554khwamyawofkselns75 mm khwamkwang4 240 phikeslkhwamsung2 120 phikeslbittxkhxmophennt8 8 8phikeslkhxmophsichnRGBkarcdwangphaphpkticanwnkhxmophennt3khwamlaexiydaenwnxn240 dpikhwamlaexiydaenwtng240 dpisxftaewrthiichAdobe Photoshop CC Windows aekikhphaphlasud10 14 18 minakhm 2557opraekrmexksophechxrtngkhaexngrunexksif Exif 2 21ewlathiaeplngepndicithl01 54 10 tulakhm 2554khwamerwchtetxr7 643856kharurbaesng A 8khwamswang APEX1 75karchdechyaesng0rurbaesngkwangsud4 APEX f 4 ohmdkarwdaesngaephtethirnaesngimthrabaeflchimichaeflch rangbichaeflchsepssiimidprbethiybtnchbbiflklxngthayphaphningdicithlchnidsinphaphthayodytrngkarpramwlphaphophlessspktiohmdexksophechxrexksophechxrtngkhaexngiwtbalansiwtbalanstngkhaexngdicithlsum0rayaofksinfilm 35 mm 112 mm chnidsinaekhpecxrpktikhwamepribbtangpktikhwamximsikhwamekhmsisungkhwamkhmpktielnsthiich70 210mm F4karihkhaaenn cak 5 0wnthiaekikhkhxmulemtalasud17 14 18 minakhm 2557ID echphaakhxngexksartnchbbE7AB1DDCCD7E293E44DA6697FDE08E21run IIM21 088