ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkar khxmulekiywkbphaphkhnadkhxngtwxyang PNG nikhxngifl SVG ni 800 400 phikesl khwamlaexiydxun 320 160 phikesl 640 320 phikesl 1 024 512 phikesl 1 280 640 phikesl 2 560 1 280 phikesl duphaphthimikhwamlaexiydsungkwa ifl SVG 1 200 600 phikesl khnadifl 183 kiolibt rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid khwamyx khaxthibayRoyal Standard of Canada 1962 2022 svg English Flag of Queen Elizabeth II for personal use in Canada 1962 2022 Each royal member has a personal flag registered with the Canadian Heraldic Authority Register of Arms Flags and Badges online version Francais Drapeau de la reine Elisabeth II pour son usage personnel au Canada 1962 2022 Registre public des armoiries drapeaux et insigneswnthi 9 knyayn ph s 2565aehlngthima Own work using World Flag Database This SVG includes elements from this Royal Standard of the United Kingdom svg This SVG includes elements from this Personal flag of Queen Elizabeth II svg This SVG includes elements from this Arms of Canada shield svg phusrangsrrkh ngankhxngtw karxnuyatichsiththi Public domain Public domain false falseThis Canadian work is in the public domain in Canada because its copyright has expired due to one of the following 1 it was subject to Crown copyright and was first published more than 50 years ago or it was not subject to Crown copyright and 2 it is a photograph that was created prior to January 1 1949 or 3 the creator died prior to January 1 1972 nxkcaknikhunxactxngephimpaysatharnsmbtiinshrthxemrika ephuxrabuwaehtuidngannicungepnsatharnsmbtiinshrthxemrika oprdthrabwangannixacimepnsatharnsmbtiinpraethsthiimidichkdrayaewlakhumkhrxnglikhsiththithisnkwa aelamikhxkahnddanlikhsiththithiyawnankwaxayukhxngphusrangsrrkhbwkipxik 60 pi odyechphaaxyangyingpraethsemksiok 100 pi caemka 95 pi okhlxmebiy 80 pi kwetmalaaelasamw 75 pi switesxraelndaelashrthxemrika 70 pi aelaewensuexla 60 pi العربية ব ল cestina Deutsch English espanol suomi francais italiano 日本語 한국어 makedonski മലയ ള Nederlands portugues portugues do Brasil sicilianu slovenscina 简体中文 繁體中文 This file depicts a coat of arms The composition of coats of arms are generally public domain with respect to copyright laws and may be reproduced freely This corresponds to the international traditional usage and is explicitly stated in some national copyright laws Some compositions of more recent origin may be copyrighted This is not a valid license as such being a public domain statement for the coat of arms definition only It must be completed with the copyright tag associated to the picture creation See Commons Coats of arms for further information Please note that this applies only to the coat of arms definition composition description The representation of a coat of arms is an artistic creation subject as such to copyright laws Restriction of use Legal notice Most of the time the usage of coats of arms is governed by legal restrictions independent of the status of the depiction shown here A coat of arms represents its owner Though it can be freely represented it cannot be appropriated or used in such a way as to create a confusion with or a prejudice to its owner Usage on Commons Please provide licence information for the coat of arm representation information for the author of the picture and the source if not self made work italiano sicilianu English العربية portugues slovenscina russkij shqip makedonski espanol svenska 日本語 中文 phaphniepnphaphthng traxarm traaephndin traprathb traphaphphimph tlxdcnekhruxnghmaykhxngthangkarxun sungkarichnganekhruxnghmaydngklawthukcakdaelakhwbkhumodykdhmayxun thiaeykipcakkdhmaylikhsiththiinhlaypraethskhabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixairixethmthiaesdngxyuiniflniprakxbdwywnthisrang wnkxtng9 knyayn 2022media type xngkvsimage svg xml prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann wnthi ewlarupyxkhnadphuichkhwamehnpccubn08 07 10 knyayn 25651 200 600 183 kiolibt Uploaded own work with UploadWizard hnathimiphaphni hnatxipni oyngmathiphaphni raychuxthnginpraethsaekhnada wikiphiediy sphakaaef xphipray kru 12 karichiflkhamokhrngkar wikixuntxipniichiflni karichbn ar wikipedia org رموز ملكية كندية karichbn be tarask wikipedia org Vikipedyya Praekt Tematychny tydzen Kanada karichbn bg wikipedia org Elizabet II karichbn ca wikipedia org Llista de les banderes del Canada karichbn co wikipedia org Elisabetta II karichbn cs wikipedia org Kanadska vlajka Seznam vlajek Alzbety II karichbn da wikipedia org Storbritanniens kongelige flag karichbn de wikipedia org Royal Standard Liste der britischen Flaggen karichbn en wikipedia org Vincent Massey Roland Michener Royal standards of Canada List of Canadian flags History of monarchy in Canada Flags of Elizabeth II Wikipedia WikiCup History 2009 Round 1 Wikipedia WikiCup Jumps Round 1 2009 Template Royal Standard CAN 1962 Diamond Jubilee of Elizabeth II User talk Miesianiacal April September 2010 Talk Time Person of the Year Archive 1 National colours of Canada List of flags with English language text User JMvanDijk Sandbox 12 Box13 karichbn es wikipedia org Isabel II del Reino Unido Estandarte Real Anexo Organizadores de los Juegos Olimpicos karichbn fr wikipedia org Monarchie canadienne Elisabeth II Etendard royal du Canada Etats dont Elisabeth II etait le chef d Etat karichbn gl wikipedia org Reinos da Commonwealth de Nacions karichbn he wikipedia org אליזבת השנייה מלכת הממלכה המאוחדת הנס המלכותי של הממלכה המאוחדת המלוכה הקנדית הנס המלכותי של קנדה דגל המלכה אליזבת השנייה תבנית דגלי המלכה אליזבת השנייה הנס המלכותי של מאוריציוס הנס המלכותי של אוסטרליה הנס המלכותי של סקוטלנד הנס המלכותי של ניו זילנד הנס המלכותי של ברבדוס karichbn hu wikipedia org II Erzsebet brit kiralyno Juharlevel karichbn it wikipedia org Elisabetta II del Regno Unito Stendardo reale britannico Giubileo di diamante di Elisabetta II del Regno Unito karichbn ja wikipedia org エリザベス2世 dukarichkhamokhrngkarephimetimkhxngiflnikhxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnnkhwamkwang1200khwamsung600