ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkar khxmulekiywkbphaphkhnadkhxngtwxyang PNG nikhxngifl SVG ni 800 500 phikesl khwamlaexiydxun 320 200 phikesl 640 400 phikesl 1 024 640 phikesl 1 280 800 phikesl 2 560 1 600 phikesl duphaphthimikhwamlaexiydsungkwa ifl SVG 960 600 phikesl khnadifl 122 kiolibt rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid khwamyx khaxthibayRoyal Standard of Canada svg English Royal Standard of Canadawnthi 6 phvsphakhm ph s 2566aehlngthima Own work using Government of Canada This SVG includes elements from this Royal Standard of the United Kingdom svg This SVG includes elements from this Arms of Canada shield svg phusrangsrrkh ngankhxngtw karxnuyatichsiththi Public domain Public domain false falseThis Canadian work is in the public domain in Canada because its copyright has expired due to one of the following 1 it was subject to Crown copyright and was first published more than 50 years ago or it was not subject to Crown copyright and 2 it is a photograph that was created prior to January 1 1949 or 3 the creator died prior to January 1 1972 nxkcaknikhunxactxngephimpaysatharnsmbtiinshrthxemrika ephuxrabuwaehtuidngannicungepnsatharnsmbtiinshrthxemrika oprdthrabwangannixacimepnsatharnsmbtiinpraethsthiimidichkdrayaewlakhumkhrxnglikhsiththithisnkwa aelamikhxkahnddanlikhsiththithiyawnankwaxayukhxngphusrangsrrkhbwkipxik 60 pi odyechphaaxyangyingpraethsemksiok 100 pi caemka 95 pi okhlxmebiy 80 pi kwetmalaaelasamw 75 pi switesxraelndaelashrthxemrika 70 pi aelaewensuexla 60 pi العربية ব ল cestina Deutsch English espanol suomi francais italiano 日本語 한국어 makedonski മലയ ള Nederlands portugues portugues do Brasil sicilianu slovenscina 简体中文 繁體中文 This file depicts a coat of arms The composition of coats of arms are generally public domain with respect to copyright laws and may be reproduced freely This corresponds to the international traditional usage and is explicitly stated in some national copyright laws Some compositions of more recent origin may be copyrighted This is not a valid license as such being a public domain statement for the coat of arms definition only It must be completed with the copyright tag associated to the picture creation See Commons Coats of arms for further information Please note that this applies only to the coat of arms definition composition description The representation of a coat of arms is an artistic creation subject as such to copyright laws Restriction of use Legal notice Most of the time the usage of coats of arms is governed by legal restrictions independent of the status of the depiction shown here A coat of arms represents its owner Though it can be freely represented it cannot be appropriated or used in such a way as to create a confusion with or a prejudice to its owner Usage on Commons Please provide licence information for the coat of arm representation information for the author of the picture and the source if not self made work italiano sicilianu English العربية portugues slovenscina russkij shqip makedonski espanol svenska 日本語 中文 phaphniepnphaphthng traxarm traaephndin traprathb traphaphphimph tlxdcnekhruxnghmaykhxngthangkarxun sungkarichnganekhruxnghmaydngklawthukcakdaelakhwbkhumodykdhmayxun thiaeykipcakkdhmaylikhsiththiinhlaypraethskhabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixairixethmthiaesdngxyuiniflniprakxbdwywnthisrang wnkxtng6 phvsphakhm 2023media type xngkvsimage svg xml prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann wnthi ewlarupyxkhnadphuichkhwamehnpccubn11 27 21 knyayn 2566960 600 122 kiolibt Reverted to version as of 12 41 6 September 2023 UTC 10 12 21 knyayn 2566991 496 961 kiolibt Vector of new Royal Standard of Canada 202319 41 6 knyayn 2566960 600 122 kiolibt Not a proper vector file12 30 6 knyayn 2566980 500 719 kiolibt 2023 version of the Royal Standard from https www canadiancrown com did you know html23 20 11 phvsphakhm 2566960 600 122 kiolibt Fry1989One more tiny alteration02 54 10 phvsphakhm 2566960 600 122 kiolibt Fry1989Minor alignment alterations01 34 10 phvsphakhm 2566960 600 122 kiolibt Fry1989Some improvements not perfect but I tried my best for the time being CHA seems to prefer the golden ratio which I have approximated to 5 8 12 15 7 phvsphakhm 2566512 256 90 kiolibt Arrange22 00 6 phvsphakhm 2566512 256 90 kiolibt Information Description Royal Standard of Canada Source https www canada ca en canadian heritage campaigns coronation his majesty king canada celebrate html Date 2023 05 06 Author Unknowm Permission PD Canada Coat of Arms insignia other versions hnathimiphaphni hnatxipni oyngmathiphaphni thngchatiaekhnada thngphraxisriyys rachxanackrekhruxckrphph raychuxthnginpraethsaekhnada phuich exdmn thdlxngekhiyn aemaebb thngchatiaekhnada karichiflkhamokhrngkar wikixuntxipniichiflni karichbn af wikipedia org Vlag van Kanada karichbn ang wikipedia org Cynewisan rice karichbn ar wikipedia org رموز كندا الوطنية راية ملكية معرض أعلام رأس الدولة karichbn bg wikipedia org Spisk na svremenni monarsi karichbn bn wikipedia org য ক তর জ য র র জক য পত ক karichbn br wikipedia org Charlez III Rouantelezh Unanet karichbn ca wikipedia org Llista de monarques sobirans actuals Llista de les banderes del Canada Coronacio de Carles III i Camil la karichbn cs wikipedia org Kanadska vlajka Seznam vladnoucich panovniku Seznam kanadskych panovniku Korunovace Karla III a Camilly karichbn da wikipedia org Canadas flag Storbritanniens kongelige flag Kongeflag Eksisterende monarkier karichbn de wikipedia org Royal Standard Commonwealth Realm Liste kanadischer Flaggen karichbn el wikipedia org Protypo Shmaies toy Kanada Shmaia toy Montreal karichbn en wikipedia org Monarchy of Canada Flag of Canada Charles III Coat of arms of Canada Maple leaf Royal standards of Canada Banner of arms List of Canadian flags National symbols of Canada History of monarchy in Canada Talk Scotland Archive 21 Wikipedia WikiCup History 2009 Main page Wikipedia WikiCup History 2009 Poster Wikipedia WikiCup History 2009 Contestants Wikipedia WikiCup History 2009 Poster Left Wikipedia WikiCup History 2009 Poster Flags Wikipedia WikiCup History 2009 Round 1 Full Wikipedia Wikipedia Signpost 2009 11 02 Article contest User Kevin McE sandbox Monarchs list Gallery of head of state standards Wikipedia Wikipedia Signpost 2009 11 02 SPV Portal Canada Symbols Flags of Charles III Wikipedia Wikipedia Signpost Single 2009 11 02 Draft Order of precedence in Newfoundland and Labrador karichbn es wikipedia org Monarquia en Canada dukarichkhamokhrngkarephimetimkhxngiflnikhxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnnkhwamkwang960khwamsung600