ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkar khxmulekiywkbphaphkhnadkhxngtwxyangni 450 600 phikesl khwamlaexiydxun 180 240 phikesl 360 480 phikesl 576 768 phikesl 768 1 024 phikesl 1 992 2 656 phikesl duphaphthimikhwamlaexiydsungkwa 1 992 2 656 phikesl khnadifl 1 4 emkaibt chnidimm image jpeg rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid khwamyx khaxthibayNASA Journey to Mars and The Martian 201508180030HQ jpg Belaruskaya Rezhysyor Rydli Skot udzelnichae y sesii pytannyay i adkazay ab padarozhzhy NASA na Mars i filme Marsiyanin aytorak 18 zhniynya 2015 goda u United Artist Theatre u La Kanyada Flintrydzh Kaliforniya Tehnichnymi kansultantami nad filmam vystupili navukoycy i inzhynery NASA Film adlyustroyvae realistychny poglyad na klimat i relef Marsa zasnavany na dadzenyh NASA i nekatoryya prablemy z yakimi sutykaecca NASA kali my ryhtuemsya da dasledavannya Chyrvonaj planety chalavekam u 2030 ya gady English Director Ridley Scott participates in a question and answer session about NASA s journey to Mars and the film The Martian Tuesday Aug 18 2015 at the United Artist Theater in La Canada Flintridge California NASA scientists and engineers served as technical consultants on the film The movie portrays a realistic view of the climate and topography of Mars based on NASA data and some of the challenges NASA faces as we prepare for human exploration of the Red Planet in the 2030s wnthi 18 singhakhm ph s 2558aehlngthima https www flickr com photos nasahqphoto 20529773070 phusrangsrrkh NASA Bill Ingalls Bill Ingalls khaxthibay American changphaphngankhwbkhumraykarhlkthan Q71171454 creator QS P170 Q71171454 This image or video was catalogued by NASA Headquarters of the United States National Aeronautics and Space Administration NASA under Photo ID 201508180030HQ This tag does not indicate the copyright status of the attached work A normal copyright tag is still required See Commons Licensing Other languages العربية belaruskaya tarashkevica blgarski catala cestina dansk Deutsch English espanol فارسی francais galego magyar հայերեն Bahasa Indonesia italiano 日本語 makedonski മലയ ള Nederlands polski portugues russkij sicilianu slovenscina Turkce ukrayinska 简体中文 繁體中文 karxnuyatichsiththi Public domain Public domain false falsephaphniepnsatharnsmbti enuxngcakepnphaphthisrangkhunodyxngkhkarbriharkarbinaelaxwkasaehngchati NASA sungtamnoybaydanlikhsiththikhxngnasarabuiwwa phaphaelasuxtang khxngnasaimidrbkarkhumkhrxngodylikhsiththiykewncarabuiwwamilikhsiththi duephimthi hnanoybaydanlikhsiththikhxngnasa hrux noybaykarichphaphkhxng JPLkhaetuxn karich olokkhxngnasa ekhruxnghmayaelaekhruxngpradbkhxngnasa thukcakddwykdhmayshrthxemrikainlksna 14 khxngkhxbngkhbthangrachkarshrthxemrika swnthi 1221 ewbistkhxngnasaekbrwbrwmphaphthimacakxngkhkarxwkasosewiyt xngkhkarxwkasaehngchatirsesiy aelaxngkhkarxwkasthimiichxngkhkarxwkaskhxngshrthxemrika epncanwnmak phaphehlaniimcaepntxngepnsatharnsmbtiesmxip phaphhruxsuxthimacak klxngothrthrrsnxwkashbebil xacmilikhsiththi hakphaphhruxsuxnnimidrabuchdecnwamacak sthabnwithyasastrklxngothrthrrsnxwkas 1 phaphhruxsuxthnghmdthimacakekhruxngmuxkhxng okhrngkarsuksadwngxathityaelalmsuriya milikhsiththi karnaphaphhruxsuxcakokhrngkaripichnxkehnuxcakkarichephuxkarkhahruxephuxkarsuksa txngidrbxnuyatkxn 2 phaphthithukkhdeluxkihepn phaphdarasastrpracawn APOD bnewbistkhxng APOD xacmilikhsiththi 3 khabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixairxngkvsDirector Ridley Scott 2015eblarusRezhysyor Rydli Skot udzelnichae y sesii pytannyay i adkazay ab padarozhzhy NASA na Mars i filme Marsiyanin aytorak 18 zhniynya 2015 goda u United Artist Theatre u La Kanyada Flintrydzh Kaliforniya ixethmthiaesdngxyuiniflniprakxbdwyphusrangBill Ingalls xngkvswnthisrang wnkxtng18 singhakhm 2015bnthukphaphdwyNikon D4 xngkvsexposure time xngkvs0 01 winathif number xngkvs3 5focal length xngkvs195 milliemtrISO speed xngkvs2 500media type xngkvsimage jpegepnphaphthay prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann wnthi ewlarupyxkhnadphuichkhwamehnpccubn01 00 26 singhakhm 25591 992 2 656 1 4 emkaibt David Levylossless crop02 55 15 mkrakhm 25591 986 2 417 1 21 emkaibt Zoom06 37 21 singhakhm 25584 497 2 964 2 67 emkaibt int filedesc Information Description en 1 Director Ridley Scott participates in a question and answer session about NASA s journey to Mars and the film The Martian Tuesday Aug 18 2015 at the United Artist Theater in La Cana hnathimiphaphni hnatxipni oyngmathiphaphni ridliy skxt karichiflkhamokhrngkar wikixuntxipniichiflni karichbn af wikipedia org Ridley Scott Cannes rolprentfees 1977 karichbn ar wikipedia org المريخي فيلم جائزة زحل لأفضل مخرج بوابة السينما الأمريكية نبذة عن فيلم 16 karichbn arz wikipedia org ريدلى سكوت karichbn ast wikipedia org Ridley Scott karichbn be wikipedia org Rydli Skot karichbn bn wikipedia org র ডল স কট ব ফট ফ ল শ প karichbn bs wikipedia org Ridley Scott karichbn ca wikipedia org Alien Blade Runner Gladiator Ridley Scott Hannibal Thelma i Louise American Gangster El regne del cel 1492 Conquest of Paradise Robin Hood pel licula de 2010 G I Jane Els impostors Black Rain Tempesta blanca Legend L ombra del testimoni Un bon any Black Hawk abatut Plantilla Ridley Scott Prometheus Exodus Gods and Kings Els duelistes The Martian Tots els diners del mon Alien Covenant House of Gucci The Counselor The Last Duel karichbn cy wikipedia org Ridley Scott karichbn de wikipedia org American Cinematheque Award Gladiator II karichbn el wikipedia org Rintlei Skot karichbn en wikipedia org Ridley Scott 1937 Blood Meridian American Cinematheque Award BAFTA Fellowship Alien film List of British films of 2016 dukarichkhamokhrngkarephimetimkhxngiflnikhxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnnphuphlitklxngNIKON CORPORATIONrunkhxngklxngNIKON D4phuthayNASA Bill Ingallsphuthrnglikhsiththi NASA Bill Ingalls ewlaepidhnaklxng1 100 winathi 0 01 khaexff 3 5xtrakhwamerw ISO2 500ewlathibnthukphaph10 46 18 singhakhm 2558khwamyawofkselns195 mm paychlakRedekhrdit phucdetriym NASA Bill Ingalls tnchbb NASA Bill Ingalls phadhwNASA Journey to Mars and The Martian chuxeruxngsnNASA Journey to Mars and The Martian amp quot chuxphaphDirector Ridley Scott participates in a question and answer session about NASA s journey to Mars and the film The Martian Tuesday Aug 18 2015 at the United Artist Theater in La Canada Flintridge California NASA scientists and engineers served as technical consultants on the film The movie portrays a realistic view of the climate and topography of Mars based on NASA data and some of the challenges NASA faces as we prepare for human exploration of the Red Planet in the 2030s Photo Credit NASA Bill Ingalls emuxngthiaesdngLa Canada Flintridgekhwamlaexiydaenwnxn240 dpikhwamlaexiydaenwtng240 dpisxftaewrthiichAdobe Photoshop Lightroom 6 1 1 Macintosh aekikhphaphlasud19 17 19 singhakhm 2558opraekrmexksophechxrtngkhaexngrunexksif Exif 2 3ewlathiaeplngepndicithl10 46 18 singhakhm 2558khwamerwchtetxr6 643856kharurbaesng A 3 61471karchdechyaesng 0 33333333333333rurbaesngkwangsud3 APEX f 2 83 ohmdkarwdaesngaephtethirnaesngthngsetn aesdngcakhlxdif aeflchimichaeflchkhwamlaexiydranabofks X1 368 888885498khwamlaexiydranabofks Y1 368 888885498hnwykhwamlaexiydranabofks3withikarwdesnesxrcudediywtnchbbiflklxngthayphaphningdicithlchnidsinphaphthayodytrngkarpramwlphaphophlessspktiohmdexksophechxrexksophechxrtngkhaexngiwtbalansiwtbalanstngkhaexngdicithlsum1rayaofksinfilm 35 mm 195 mm chnidsinaekhpecxrpktisinkhxnothrlekn sung khunkhwamepribbtangpktikhwamximsipktikhwamkhmpktirayahangwtthuimthrabhmayelkhsieriylkhxngklxng2037546elnsthiich70 0 200 0 mm f 2 8wnthiaekikhkhxmulemtalasud15 17 19 singhakhm 2558karihkhaaenn cak 5 5phuekhiynbikhaaenanaphiessMANDATORY CREDIT NASA Bill Ingalls rhstaaehnngthitngkarsngdngedim201508180030HQID echphaakhxngexksartnchbb4C30E9046A4EF280375DD9C212D3A9DBkhxmulsahrbtidtxhttp www nasa gov NASA Headquarters 300 E Street SW Washington DC 20546 USA 202 358 1900khasakhyCalifornia La Canada Flintridge Matt Damon Ridley Scott The Martian United Artist TheaterrhssahrbpraethsthiaesdngUSAtaaehnngthitngyxykhxngemuxngthiaesdngUnited Artist TheatercnghwdhruxrththiaesdngCApraethsthiaesdngUSArun IIM4