ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkar khxmulekiywkbphaphimmiphaphthimiraylaexiydsungkwani Jigme Dorji Wangchuck cropped jpg 53 70 phikesl khnadifl 13 kiolibt chnidimm image jpeg rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid khwamyx khaxthibayJigme Dorji Wangchuck cropped jpg English Picture taken on the occasion of the visit of the Maharaja of Bhutan to the International Low Cost Housing Exhibition in New Delhi The Maharaja and the Maharani are dressed in the Bhutanese style wnthi 30 mkrakhm ph s 2497aehlngthima http photodivision gov in waterMarkdetails asp id 36922 jpgphusrangsrrkh Photo Division Govt of Indiaewxrchnxun iflnithukaeykmacakiflxun Maharaja of Bhutan at the International Lowcost Housing Exhibition jpg karxnuyatichsiththi Public domain Public domain false falseThis work is in the public domain in India because its term of copyright has expired The Indian Copyright Act applies in India to works first published in India According to the Indian Copyright Act 1957 as amended up to Act No 27 of 2012 Chapter V Section 25 Anonymous works photographs cinematographic works sound recordings government works and works of corporate authorship or of international organizations enter the public domain 60 years after the date on which they were first published counted from the beginning of the following calendar year i e as of 2024 works published prior to 1 January 1964 are considered public domain Posthumous works other than those above enter the public domain after 60 years from publication date counted from the beginning of the following calendar year Any kind of work other than the above enters the public domain 60 years after the author s death or in the case of a multi author work the death of the last surviving author counted from the beginning of the following calendar year Text of laws judicial opinions and other government reports are free from copyright The Indian Copyright Act 1957 is not retroactive so any work in which copyright did not subsist when it commenced did not have its copyright restored and is in the public domain per the Copyright Act 1911 nxkcaknikhunxactxngephimpaysatharnsmbtiinshrthxemrika ephuxrabuwaehtuidngannicungepnsatharnsmbtiinshrthxemrika oprdthrabwangannixacimepnsatharnsmbtiinpraethsthiimidichkdrayaewlakhumkhrxnglikhsiththithisnkwa aelamikhxkahnddanlikhsiththithiyawnankwaxayukhxngphusrangsrrkhbwkipxik 60 pi odyechphaapraethsemksiok 100 pi caemka 95 pi okhlxmebiy 80 pi kwetmalaaelasamw 75 pi switesxraelndaelashrthxemrika 70 pi العربي ة ব ল Deutsch English francais ह न द italiano 日本語 ಕನ ನಡ makedonski മലയ ള मर ठ Nederlands portugues do Brasil sicilianu தம ழ ತ ಳ اردو 繁體中文 phaphni idrbkarprbaetngphaph sunghmaykhwamwacaidrbkarepliynaeplngphaphtangcaktnchbb karprbprung removed the person in the background prbaetngphaphody PawelMM iflnithukaeykmacakiflxun Jigme Dorji Wangchuck Maharaja of Bhutan at the International Lowcost Housing Exhibition jpgkhabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixairixethmthiaesdngxyuiniflniprakxbdwysmedcphrarachathibdicikmi dxrci wngchuk prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann wnthi ewlarupyxkhnadphuichkhwamehnpccubn19 14 19 singhakhm 256353 70 13 kiolibt Uploaded own work with UploadWizard hnathimiphaphni hnatxipni oyngmathiphaphni phramhakstriyphutan rachwngswngchuk karichiflkhamokhrngkar wikixuntxipniichiflni karichbn ar wikipedia org ملك بوتان قائمة رؤساء وزراء بوتان karichbn en wikipedia org Jigme Singye Wangchuck Jigme Wangchuck Jigme Dorji Wangchuck List of prime ministers of Bhutan List of rulers of Bhutan Ugyen Wangchuck King of Bhutan List of chief guests at Delhi Republic Day parade Template Wangchuck Kings of Bhutan karichbn es wikipedia org Anexo Monarcas de Estados soberanos del siglo XX karichbn fi wikipedia org Luettelo Bhutanin hallitsijoista karichbn id wikipedia org Templat Raja Wangchuck Bhutan karichbn ko wikipedia org 드루크걀포 부탄의 용왕 목록 karichbn mr wikipedia org ज ग म द रज व गच क भ त नच प तप रध न karichbn ne wikipedia org भ ट नक प रध नमन त र हर क स च भ ट नक र ज karichbn no wikipedia org Liste over Bhutans konger karichbn pl wikipedia org Wladcy Bhutanu karichbn ru wikipedia org Korol Butana Spisok premer ministrov Butana Spisok glav gosudarstv v 1958 godu Spisok glav gosudarstv v 1957 godu Spisok glav gosudarstv v 1956 godu Spisok glav gosudarstv v 1955 godu Spisok glav gosudarstv v 1954 godu Spisok glav gosudarstv v 1953 godu Spisok glav gosudarstv v 1952 godu Spisok glav gosudarstv v 1959 godu Spisok glav gosudarstv v 1960 godu Spisok glav gosudarstv v 1961 godu Spisok glav gosudarstv v 1962 godu Spisok glav gosudarstv v 1963 godu Spisok glav gosudarstv v 1964 godu Spisok glav gosudarstv v 1965 godu Spisok glav gosudarstv v 1966 godu Spisok glav gosudarstv v 1967 godu Spisok glav gosudarstv v 1968 godu Spisok glav gosudarstv v 1969 godu Spisok glav gosudarstv v 1970 godu Spisok glav gosudarstv v 1971 godu Spisok glav gosudarstv v 1972 godu karichbn simple wikipedia org Prime Minister of Bhutan karichbn ta wikipedia org ஜ க ம த ர ஜ வ ங ச க karichbn tr wikipedia org Bhutan krallari listesi karichbn vi wikipedia org Jigme Singye Wangchuck Bản mẫu Vua Bhutan thuộc vương triều Wangchuck dukarichkhamokhrngkarephimetimkhxngiflnikhxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnnkarcdwangphaphpktikhwamlaexiydaenwnxn72 dpikhwamlaexiydaenwtng72 dpisxftaewrthiichAdobe Photoshop CC 2017 Windows aekikhphaphlasud20 14 19 singhakhm 2563sepssiimidprbethiybewlathiaeplngepndicithl04 14 20 singhakhm 2563wnthiaekikhkhxmulemtalasud04 14 20 singhakhm 2563ID echphaakhxngexksartnchbbxmp did 1466c514 3ce0 ba45 8623 9f924e1a48ea