ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkar khxmulekiywkbphaphkhnadkhxngtwxyangni 800 537 phikesl khwamlaexiydxun 320 215 phikesl 640 429 phikesl 1 024 687 phikesl 1 280 859 phikesl 2 641 1 772 phikesl duphaphthimikhwamlaexiydsungkwa 2 641 1 772 phikesl khnadifl 1 23 emkaibt chnidimm image jpeg rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid khwamyx khaxthibayGreat Theatre Poznan cropped jpg English The Great Theatre Opera in Poznan The Scotch Mist Gallery contains many photographs of historic buildings monuments and memorials of Poland Polski Galeria Mist Scotch zawiera wiele zdjec zabytkowych budowli pomnikow i miejsc pamieci w Polsce wnthi 29 krkdakhm ph s 2553aehlngthima ngankhxngtwphusrangsrrkh Scotch Mistkarxnuyat karichiflniihm This image is not public domain please respect the copyright protection The image may only be used in accordance with the terms of the applicable licensing specified below and use in social media is excluded without the direct permission of the Author Please feel free to make use of this image but note the Author as Scotch Mist and send a courtesy message to Scotch Mist Talk Should you wish to make any changes to this image please first contact the Author and subject to confirmation of acceptance of any changes please feel free to upload the new image under a new name making use of the derivative or extract template as appropriate Thank you ewxrchnxun iflnithukaeykmacakiflxun Great Theatre Poznan jpg taaehnngthitngklxng52 24 29 66 ehnux 16 54 59 87 tawnxxk phaphniaelaphaphxun n sthanthiediywknthi OpenStreetMap52 408239 16 916631 karxnuyatichsiththi Scotch Mist inthanaphuthuxlikhsiththikhxngphaphhruxsuxni xnuyatihichphaphhruxsuxniphayitenguxnikhtxipni iflnixyuphayitsyyaxnuyat khriexthifkhxmmxns aebbaesdngthima xnuyataebbediywkn 4 0 nanachatikaraesdngthima c Scotch Mist Wikimedia Commons CC BY SA 4 0khunsamarth thicaaebngpn thicathasaena aeckcay aelasngngandngklawtxip thicaeriyberiyngihm thicaddaeplngngandngklaw phayitenguxnikhtxipni aesdngthima khuntxngihekiyrtiecakhxngnganxyangehmaasm odyephimlingkipyngsyyaxnuyat aelarabuhakmikarepliynaeplng khunxacthaechnniidinrupaebbidkidtamkhwr aettxngimichinlksnathiaenawaphuihxnuyatsnbsnunkhunhruxkarichngankhxngkhun xnuyataebbediywkn hakkhunddaeplng epliynrup hruxtxetimnganni khuntxngichsyyaxnuyataebbediywknhruxaebbthiehmuxnkbsyyaxnuyatthiichkbnganniethannhttps creativecommons org licenses by sa 4 0 CC BY SA 4 0 Creative Commons Attribution Share Alike 4 0 true truekhabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixairixethmthiaesdngxyuiniflniprakxbdwyGrand Theatre Poznan xngkvsphusrangbangkhathiimmiixethmwikisnethschuxphuichwikimiediy Scotch Mistyuxaraexl https commons wikimedia org wiki User Scotch Mistchuxphusrangsrrkh Scotch MiststhanalikhsiththimilikhsiththisyyaxnuyatCreative Commons Attribution ShareAlike 4 0 International xngkvsbnthukphaphdwyCanon PowerShot SX100 IS xngkvswnthisrang wnkxtng29 krkdakhm 2010thimakhxngiflkarsrangdngedimodyphuxpohldmedia type xngkvsimage jpegchecksum xngkvs1e01b5e7df2f29edc9be1ac57f0e77f5c035bd4dwithikarkahnd SHA 1 xngkvsdata size xngkvs1 284 658 ibtkhwamsung1 772 phikeslkhwamkwang2 641 phikeslcoordinates of the point of view xngkvs52 24 29 660 N 16 54 59 872 E prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann wnthi ewlarupyxkhnadphuichkhwamehnpccubn04 29 17 phvscikayn 25642 641 1 772 1 23 emkaibt Andrew J KurbikoCropped 7 horizontally 1 vertically rotated 0 4 using CropTool with precise mode 17 29 14 knyayn 25642 848 1 798 1 44 emkaibt Andrew J KurbikoFile Great Theatre Poznan jpg cropped 6 horizontally 21 vertically using CropTool with precise mode hnathimiphaphni hnatxipni oyngmathiphaphni pxsny karichiflkhamokhrngkar wikixuntxipniichiflni karichbn bn wikipedia org পজন ন karichbn en wikipedia org Poznan karichbn fr wikipedia org Poznan karichbn it wikipedia org Poznan karichbn uk wikipedia org Poznankhxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnnphuphlitklxngCanonrunkhxngklxngCanon PowerShot SX100 ISewlaepidhnaklxng1 640 winathi 0 0015625 khaexff 4xtrakhwamerw ISO80ewlathibnthukphaph16 48 29 krkdakhm 2553khwamyawofkselns12 8 mm karcdwangphaphpktiaekikhphaphlasud16 48 29 krkdakhm 2553taaehnng Y aela Ckungklangrunexksif Exif 2 2ewlathiaeplngepndicithl16 48 29 krkdakhm 2553khwamhmaykhxngaetlakhxmophenntY Cb Cr immikhaohmdkarbibxdphaph3khwamerwchtetxr9 3125kharurbaesng A 4karchdechyaesng0rurbaesngkwangsud3 625 APEX f 3 51 ohmdkarwdaesngaephtethirnaeflchimichaeflch rangbichaeflchesiywwinathi wnthi ewlatnchbb00esiywwinathi wnthi ewlathidiciiths00runaeflchphiksthirxngrb1sepssisRGBkhwamlaexiydranabofks X14 506 666666667khwamlaexiydranabofks Y14 485 207100592hnwykhwamlaexiydranabofksniwwithikarwdesnesxrcudediywtnchbbiflklxngthayphaphningdicithlkarpramwlphaphophlessspktiohmdexksophechxrexksophechxrxtonmtiiwtbalansiwtbalansxtonmtidicithlsum1chnidsinaekhpecxrpkti