ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkar khxmulekiywkbphaphkhnadkhxngtwxyang PNG nikhxngifl SVG ni 800 400 phikesl khwamlaexiydxun 320 160 phikesl 640 320 phikesl 1 024 512 phikesl 1 280 640 phikesl 2 560 1 280 phikesl duphaphthimikhwamlaexiydsungkwa ifl SVG 1 200 600 phikesl khnadifl 161 ibt rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid khwamyx khaxthibayFlag of Latvia svg Cestina Lotysska vlajka Dansk Letlands flag Deutsch Flagge Lettlands Eesti Lati lipp English Flag of Latvia Section 2 Description of the National Flag of LatviaThe national flag of Latvia is carmine with a white horizontal stripe The red white red stripe ratio of the national flag of Latvia is 2 1 2 The width to length ratio of the National flag of Latvia is 1 2 The red white red ratio of the national flag of Latvia as well as the width to length ratio irrespective of the dimensions of the flag shall conform to the sample indicated in Annex 1 to this Law The national flag of Latvia is a Latvian State symbol If the national flag of Latvia or the pennant of the national flag of Latvia is made from a textile the carmine colour thereof shall conform with the Pantone Textile Colour System 19 1629 TPX or 19 1629 TC Colour Code The 27 November 2018 amendment which came into force 1 January 2019 states that non fabric flags as well as representations produced using other techniques including digital representations use Pantone 201 C Espanol Bandera de Letonia Esperanto Flago de Latvio Francais Drapeau de la Lettonie Gaeilge Bratach Laitvia Hrvatski Zastava Latvije Italiano Bandiera lettone Latgalu Latvejas karugs Latviesu Latvijas karogs 2 pants Latvijas valsts karoga apraksts Latvijas valsts karogs ir karminsarkans ar baltu horizontalu svitru Latvijas valsts karoga sarkanbaltsarkano svitru attieciba ir 2 1 2 Latvijas valsts karoga platuma un garuma attieciba ir 1 2 Latvijas valsts karoga sarkanbaltsarkano svitru attieciba ka ari karoga platuma un garuma attieciba neatkarigi no karoga izmeriem atbilst sa likuma 1 pielikuma noraditajam paraugam Latvijas valsts karogs ir Latvijas valsts simbols Karminsarkana auduma krasa atbilst Pantone Textile Colour System 19 1629 TPX vai 19 1629 TC krasas kodam Lietuviu Latvijos veliava Magyar Lettorszag zaszlaja Malti Bandiera tal Latvja Nederlands Vlag van Letland Polski Flaga Lotwy Portugues Bandeira da Letonia Romană Drapelul Letoniei Slovencina Vlajka Lotysska Slovenscina Zastava Latvije Suomi Latvian lippu Svenska Lettlands flagga Ellhnika Shmaia ths Lettonias Belaruskaya Scyag Latvii Belaruskaya tarashkevica Scyag Latvii Blgarski Nacionalno zname na Latviya Russkij Flag Latvii Ukrayinska Prapor Latviyi ქართული ლატვიის დროშა wnthi 28 knyayn ph s 2548aehlngthima ngankhxngtw References 1 IV 18 21 Latvijas valsts karoga likums IV 18 phusrangsrrkh SKoppewxrchnxun iflxunthiichiflni Flag of Latvia with border svg Flag of Latvia 3 2 svg Flag of Latvia Textile svgSVG genesisInfoField sxrsokhdkhxng SVG nitrwcsxbthuktxngaelw iflphaphewketxrni srangkhunodyichopraekrmaekikhkhxkhwam Please do not replace the simplified code of this file with a version created with Inkscape or any other vector graphics editor karxnuyatichsiththi phaphniepnphaphthng traxarm traaephndin traprathb traphaphphimph tlxdcnekhruxnghmaykhxngthangkarxun sungkarichnganekhruxnghmaydngklawthukcakdaelakhwbkhumodykdhmayxun thiaeykipcakkdhmaylikhsiththiinhlaypraethsPublic domain Public domain false falseCopyright Law of the Republic of Latvia of April 6 2000 Full text pdf Section 6 Non Protected Works The following shall not be protected by copyright regulatory enactments and administrative rulings other documents issued by the State and Local Governments and adjudications of courts laws court judgements decisions and other official documents as well as official translations of such texts and official consolidated versions State approved as well as internationally recognised official symbols and signs flags Coats of Arms anthems and awards the use of which is subject to specific regulatory enactments maps the preparation and use of which are determined by regulatory enactments information provided in the press radio or television broadcasts or other information media concerning news of the day and various facts and events ideas methods processes and mathematical concepts English latgalu latviesu makedonski russkij ukrayinska khabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixairxngkvsFlag of Latviacintwyx拉脱维亚国旗xinodniesiyBendera Latviahibruדגל לטביהltewiyLatvijas valsts karogsrsesiyFlag LatviisepnBandera de LetoniaturkiLetonya bayragioprtueksBandeira da Letoniaxahrbعلم لاتفياfrngessDrapeau de la Republique de Lettonieyiddichפאן לעטלאנדdtchVlag van Letlandyipunラトビアの旗yuekhrnDerzhavnij prapor Latvijskoyi Respublikiepxresiyپرچم لتونیhngkariLett zaszloexsoteniylati lippeyxrmnFlagge LettlandsewiydnamQuốc kỳ LatviaeblarusScyag LatviiopaelndFlaga LotwynxrewybukhmxlFlagget til Latviaixethmthiaesdngxyuiniflniprakxbdwythngchatiltewiysthanalikhsiththicopyrighted dedicated to the public domain by copyright holder xngkvssyyaxnuyatreleased into the public domain by the copyright holder xngkvsepnsylksnkhxngpraethsltewiywnthisrang wnkxtng28 knyayn 2005thimakhxngiflkarsrangdngedimodyphuxpohldmedia type xngkvsimage svg xml prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann lasud du ihmkwa 10 10 wnthi ewlarupyxkhnadphuichkhwamehnpccubn07 48 9 phvsphakhm 25671 200 600 161 ibt You are converting it againts the specifications from the source If you have a case state it in the discussion page and stop reverting 07 41 9 phvsphakhm 25671 200 600 218 ibt ImStevanReverted to version as of 13 12 8 May 2024 UTC The digital flag is at File Flag of Latvia digital svg21 31 8 phvsphakhm 25671 200 600 161 ibt Reverted to version as of 20 45 6 May 2024 UTC 20 12 8 phvsphakhm 25671 200 600 218 ibt ImStevanReverted to version as of 06 28 1 April 2024 UTC until we discuss this en Wikipedia talk WikiProject Heraldry and vexillology Digital and physical flags 03 45 7 phvsphakhm 25671 200 600 161 ibt Reverted to version as of 00 39 1 April 2024 UTC so imstevan didnt give any kind of actual reasoning behind this change aside from per flag laws when that also literally says what the digital colors are meant to be so this is meant to be using digital colors NOT the print one13 28 1 emsayn 25671 200 600 218 ibt ImStevanReverted to version as of 23 32 31 March 2024 UTC Digital flag is at File Flag of Latvia digital svg this file should be show the textile colors as it did originally07 39 1 emsayn 25671 200 600 161 ibt Reverted to version as of 23 35 2 August 2023 UTC textile colors are not 1 1 digital colors 06 32 1 emsayn 25671 200 600 218 ibt ImStevanper sources laid out in the description latvian flag laws 06 35 3 singhakhm 25661 200 600 161 ibt Reverted to version as of 21 01 7 July 2023 UTC 06 33 3 singhakhm 25661 200 600 197 ibt Reverted to version as of 20 20 25 March 2018 UTC lasud du ihmkwa 10 10 hnathimiphaphni mihnathiichiflnimakkwa 100 hna raykartxipniaesdnghnathiichiflni 100 hnaaerkethann miraykaretmISO 3166 1 ISO 4217 karprakwdephlngyuorwichn karprachumexechiy yuorp karlmslaykhxngshphaphosewiyt kilaoxlimpik khwamtay dchnikarphthnamnusy dchniphaphlksnkhxrrpchn dawethiym tladhlkthrphyniwyxrk tladhlkthrphyaehngpraethsithy tladhlkthrphyotekiyw thwipyuorp thirethph wionthy nphaphr tngsali praethskris praethskalngphthna praethsturki praethsnxrewy praethsblaekeriy praethsfrngess praethsfinaelnd praethsmxnetenokr praethsmasiodeniyehnux praethslkesmebirk praethsltewiy praethslithweniy praethsswiedn praethssepn praethssolwaekiy praethssolwieniy praethsxitali praethshngkari praethsechkekiy praethsednmark praethsenethxraelnd praethsebleyiym praethseyxrmni praethsexsoteniy praethsaekhnada praethsaexlebeniy praethsokhrexechiy praethsoprtueks praethsopaelnd praethsormaeniy praethsixsaelnd futbxlchingthwyphrarachthankhingskhph futbxlthimchatifrngess futbxlthimchatixngkvs futbxlthimchatixitali futbxlthimchatienethxraelnd futbxlthimchatieyxrmni futbxlthimchatiithy phasarsesiy phasimulkhaephim misetxrenchnaenlyuniewirs yuor rhsothrsphthrahwangpraeths raychuxpramukhaehngrthaelahwhnarthbalpccubn raychuxpraeths dinaedn aelaemuxnghlwng raychuxpraethstamcanwnphupwyorkhexds raychuxpraethstamrabxbkarpkkhrxng raychuxpraethstamxtrakarekid raychuxpraethstamxtrakaresiychiwit raychuxpraethseriyngtamkhwamhnaaennprachakr raychuxpraethseriyngtamcanwnprachakr raychuxpraethseriyngtamdchnikarphthnamnusy raychuxpraethseriyngtamphlitphnthmwlrwminpraeths rakhatlad raychuxpraethsaelaekhtkarpkkhrxngeriyngtamkhnadphunthithnghmd raychuxrhspraethsodyfifa rika wnexkrach sngkhramklangemuxngrsesiy snthisyyaaewrsay smedcphrarachathibdikharlthi 16 kustafaehngswiedn smedcphrarachininathmarekrethxthi 2 aehngednmark smedcphrarachininathebiythriksaehngenethxraelnd shphaphyuorp shphaphsmakhmfutbxlyuorp shphaphosewiyt shrth shrachxanackr somsrfutbxlxaresnxl xngkhkarephuxkhwamrwmmuxthangesrsthkicaelakarphthna xksrlatin ekhiyf enoth efrnchoxephn emuxnghlwngthangwthnthrrmkhxngyuorp eyerwan exm 16 aekrnddyukxxngriaehnglkesmebirk aethmmarin thnsukaycn aensaedk okheba othspraharchiwit oxlimpikvdurxn 2008 oxlimpikvdurxn 2012 aemaebb LAT dukarechuxmoyngmayngiflniephimetim karichiflkhamokhrngkar wikixuntxipniichiflni karichbn ab wikipedia org Aҳәynҭkarrakәa rsia Adunei aҳҭnykalakkәa ryhӡynҵa Ametropolitenkәa ryhӡynҵa Latvia Ashablon Abiraҟdyrga Latvia Ashablon LVA karichbn ace wikipedia org Ierupa karichbn ady wikipedia org Latvie karichbn af wikipedia org Denemarke Europa Estland Europese Unie Finland Swede Duits Olimpiese Somerspele 1924 Letland Litaue Ysland Groenland Faroereilande Noorwee Sapmi Rusland Lys van hoofstede Euro Lets Litaus Esties Belarussies Jiddisj Pools Russies Koers Lys van lande volgens bevolking Gebruiker Sobaka Moskou OESO Russe Tallinn Warskou NAVO Bordeaux Georgiese nasionale rugbyspan Nederlandse nasionale rugbyspan Lys van lande Duitse nasionale rugbyspan Tsjeggiese nasionale rugbyspan Belgiese nasionale rugbyspan Sjabloon Landdata Letland dukarichkhamokhrngkarephimetimkhxngiflnikhxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnnkhwamkwang1200khwamsung600