ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkar khxmulekiywkbphaphkhnadkhxngtwxyang PNG nikhxngifl SVG ni 800 400 phikesl khwamlaexiydxun 320 160 phikesl 640 320 phikesl 1 024 512 phikesl 1 280 640 phikesl 2 560 1 280 phikesl 1 000 500 phikesl duphaphthimikhwamlaexiydsungkwa ifl SVG 1 000 500 phikesl khnadifl 48 kiolibt rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid khwamyx khaxthibayFlag of American Samoa svg English Flag of American Samoa United StatesGagana Samoa Fu a o Amerika SamoaEspanol Bandera de Samoa AmericanaFrancais Drapeau des Samoa americainesItaliano Bandiera delle Samoa AmericaneDeitsch Faahne vun Amerikaanisch Samoawnthi 27 emsayn ph s 2503aehlngthima It is from openclipart org specifically american samoa svg phusrangsrrkh by Tobias Jakobskarxnuyat karichiflniihm Public domain Public domain false falsephlnganchinniepn satharnsmbti ephraaidmikartiphimphinshrthxemrikatngaet ph s 2472 thung ph s 2520 kh s 1929 thung kh s 1977 phlnganthikhlxbkhlumxyuinpiehlani ihthuxwaplxdsungprakaskarthuxlikhsiththi nxkcakecakhxngphlngannnidesiychiwitinchwnghlaypithiphanma phlnganchinnixacmilikhsiththiinpraeths hruxphunthithiimidbngkhbichkdrayasn sahrbphlngankhxngshrth xyangechn aekhnada 50 p m a cinaephndinihy 50 p m a imrwmhxngkng hrux maeka eyxrmni 70 p m a emksiok 100 p m a swisesxraelnd 70 p m a aelapraethsxun thimisnthisyyaswnbukhkhlkhxngpraethsnn oprdduthihnanisahrbkhaxthibayephimetim العربية belaruskaya tarashkevica cestina Deutsch Ellhnika English espanol francais Bahasa Indonesia italiano 日本語 한국어 makedonski Nederlands portugues russkij sicilianu slovenscina ithy Tiếng Việt 中文 简体 中文 繁體 Flag of the United StatesPublic domain Public domain false falseThis image shows a flag a coat of arms a seal or some other official insignia produced by the United States Army Institute of Heraldry It is in the public domain but its use is restricted by Title 18 United States Code Section 704 1 and the Code of Federal Regulations 32 CFR Part 507 2 3 Permission to use these images in the USA for most commercial purposes must be obtained from The Institute of Heraldry prior to their use Deutsch English فارسی 日本語 russkij Public domain Public domain false falseThis work is based on a work in the public domain It has been digitally enhanced and or modified This derivative work has been or is hereby released into the public domain by its author Open Clip Art Library This applies worldwide In some countries this may not be legally possible if so Open Clip Art Library grants anyone the right to use this work for any purpose without any conditions unless such conditions are required by law phaphniepnphaphthng traxarm traaephndin traprathb traphaphphimph tlxdcnekhruxnghmaykhxngthangkarxun sungkarichnganekhruxnghmaydngklawthukcakdaelakhwbkhumodykdhmayxun thiaeykipcakkdhmaylikhsiththiinhlaypraethsewxrchnxun iflxunthiichiflni Flag of American Samoa Pantone svgIt is easy to put a border around this flag image File Flag of American Samoa svg border 96x176px karxnuyatichsiththi phaphnimacak oxephnkhlipxartilbrari sungephyaephrlikhsiththiinrupaebb satharnsmbti duthini sahrbphuxpohld oprdrabupharamietxrechuxmoyngipynghnaewbtnchbbkhxngphaphni italiano sicilianu Deutsch cestina portugues do Brasil romană espanol portugues English francais Indonesia Nederlands Malti polski svenska Turkce Ellhnika blgarski makedonski russkij ukrayinska ব ল ithy 日本語 中文 中国大陆 中文 台灣 中文 新加坡 中文 简体 中文 繁體 中文 香港 Open Clip Art Library logo iflnimiihichphayit CC0 1 0 Universal Public Domain Dedication khxngkhriexthifkhxmmxnsThe person who associated a work with this deed has dedicated the work to the public domain by waiving all of their rights to the work worldwide under copyright law including all related and neighboring rights to the extent allowed by law You can copy modify distribute and perform the work even for commercial purposes all without asking permission http creativecommons org publicdomain zero 1 0 deed en CC0 Creative Commons Zero Public Domain Dedication false falsephaphniepnphaphthng traxarm traaephndin traprathb traphaphphimph tlxdcnekhruxnghmaykhxngthangkarxun sungkarichnganekhruxnghmaydngklawthukcakdaelakhwbkhumodykdhmayxun thiaeykipcakkdhmaylikhsiththiinhlaypraethskhabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixairxngkvsFlag of American Samoaxngkvs shrachxanackrFlag of American Samoa United States of America xahrbعلم ساموا الأمريكيةrsesiyFlag Amerikanskogo Samoa Soedinennye ShtatyeyxrmnFlagge der amki rikanischen Salomonenixethmthiaesdngxyuiniflniprakxbdwythngchatixemriknsamwsthanalikhsiththicopyrighted dedicated to the public domain by copyright holder xngkvssatharnsmbtisyyaxnuyatCreative Commons CC0 License xngkvsreleased into the public domain by the copyright holder xngkvswnthisrang wnkxtng27 emsayn 1960media type xngkvsimage svg xmlchecksum xngkvs0242b62ead2f6bebe55709eaa3d5b096d5707ebdwithikarkahnd SHA 1 xngkvsdata size xngkvs49 138 ibtkhwamsung500 phikeslkhwamkwang1 000 phikesl prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann wnthi ewlarupyxkhnadphuichkhwamehnpccubn22 25 27 mkrakhm 25621 000 500 48 kiolibt reduce size22 24 27 mkrakhm 25621 000 500 48 kiolibt reduce size05 33 4 kumphaphnth 25611 000 500 54 kiolibt Optimized17 26 1 singhakhm 25601 000 500 206 kiolibt Reverted to version as of 02 26 1 January 2016 UTC 16 34 1 singhakhm 2560320 163 87 kiolibt american samoa09 26 1 mkrakhm 25591 000 500 206 kiolibt Fixed Black Colour08 55 1 mkrakhm 25591 000 500 206 kiolibt New version of The Eagle fixed elements 20 43 23 krkdakhm 25561 000 500 13 kiolibt SiBr4Rounding off dimensions amp reducing code06 15 14 tulakhm 2548992 496 36 kiolibt Dbenbennfrom http openclipart org clipart signs and symbols flags oceania polynesia american samoa svg by Tobias Jakobs PD hnathimiphaphni mihnathiichiflnimakkwa 100 hna raykartxipniaesdnghnathiichiflni 100 hnaaerkethann miraykaretmISO 3166 1 ISO 4217 kilamhawithyalyolkvdurxn 1995 kilaoxlimpik khnaphuaethnthangthutkhxngpraethsmldifs dinaednxemriknsamwinoxlimpikvdurxn 2008 thngchatixemriknsamw nkkilaoxlimpikechphaabukhkhlinoxlimpikvdurxn 2000 praethskrisinoxlimpikvdurxn 2004 praethskmphuchainoxlimpikvdurxn 2008 praethscinithepinoxlimpikvdurxn 2008 praethsyipuninoxlimpikvdurxn 2008 praethsturkiinoxlimpikvdurxn 2008 praethsbrasilinoxlimpikvdurxn 2008 praethsbxtswanainoxlimpikvdurxn 2008 praethsbxseniyaelaehxresokwinainoxlimpikvdurxn 2008 praethsblaekeriyinoxlimpikvdurxn 2008 praethsbarebodsinoxlimpikvdurxn 2008 praethsbaherninoxlimpikvdurxn 2008 praethsbahamasinoxlimpikvdurxn 2008 praethsburundiinoxlimpikvdurxn 2008 praethsburkinafaosinoxlimpikvdurxn 2008 praethsxxsetriyinoxlimpikvdurxn 2008 praethsxxsetreliyinoxlimpikvdurxn 2008 praethsxndxrrainoxlimpik praethsxndxrrainoxlimpikvdurxn 2008 praethsxfkanisthaninoxlimpikvdurxn 2004 praethsxarmieniyinoxlimpikvdurxn 2008 praethsxarecntinainoxlimpikvdurxn 2008 praethshngkariinoxlimpikvdurxn 2004 praethsebnininoxlimpikvdurxn 2008 praethseblisinoxlimpikvdurxn 2008 praethsebleyiyminoxlimpikvdurxn 2008 praethsebxrmiwdainoxlimpikvdurxn 2008 praethsaekhnadainoxlimpikvdurxn 2008 praethsaexngoklainoxlimpik praethsaexngoklainoxlimpikvdurxn 2008 praethsaexnthikaaelabarbiwdainoxlimpik praethsaexnthikaaelabarbiwdainoxlimpikvdurxn 2008 praethsaexlebeniyinoxlimpik praethsaexlebeniyinoxlimpikvdurxn 2004 praethsithyinoxlimpik praethsithyinoxlimpikvdurxn 1988 praethsithyinoxlimpikvdurxn 1992 praethsithyinoxlimpikvdurxn 1996 praethsithyinoxlimpikvdurxn 2000 praethsithyinoxlimpikvdurxn 2004 praethsithyinoxlimpikvdurxn 2008 phuekharwmoxlimpikodyxisrainoxlimpikvdurxn 1992 phxliniechiy futbxlthimchatixxsetreliy mhasmuthraepsifik misaexmbassedxr rhsothrsphthrahwangpraeths raychuxthnginshrthxemrika raychuxpraeths dinaedn aelaemuxnghlwng raychuxpraethstamxtrakarekid raychuxpraethstamxtrakaresiychiwit raychuxpraethseriyngtamkhwamhnaaennprachakr raychuxpraethseriyngtamcanwnprachakr raychuxpraethsaelaekhtkarpkkhrxngeriyngtamkhnadphunthithnghmd raychuxrhspraethsodyfifa raychuxekaaeriyngtamkhnad raynamphuechiythngchatiekhasusnaminphithiepidkaraekhngkhnoxlimpikvdurxn 2008 srupehriyyrangwloxlimpiktlxdkal shrthinoxlimpik shrthinoxlimpikvdurxn 2008 shrachxanackrinoxlimpikvdurxn 2004 satharnrthprachachnbngklaethsinoxlimpikvdurxn 2008 satharnrthprachathipityprachachnaexlcieriyinoxlimpikvdurxn 2008 satharnrthxaesxribcaninoxlimpikvdurxn 2008 satharnrthxislamxfkanisthaninoxlimpikvdurxn 1996 satharnrthxislamxfkanisthaninoxlimpikvdurxn 2008 satharnrtheblarusinoxlimpikvdurxn 2008 satharnrthaexlebeniyinoxlimpikvdurxn 2000 satharnrthaexlebeniyinoxlimpikvdurxn 2008 satharnrthobliewiyinoxlimpikvdurxn 2008 hmuekaabritichewxrcininoxlimpikvdurxn 2008 xarubainoxlimpik xarubainoxlimpikvdurxn 2008 xemriknsamw ekhtbriharphiesshxngknginoxlimpikvdurxn 2008 aephndinihwinhmuekaasamw ph s 2552 oxlimpikvdurxn oxlimpikvdurxn 1988 oxlimpikvdurxn 1992 oxlimpikvdurxn 1996 oxlimpikvdurxn 2000 oxlimpikvdurxn 2004 oxlimpikvdurxn 2008 oxlimpikvdurxn 2012 oxlimpikvdurxn 2016 oxlimpikvdurxn 2020 oxlimpikvduhnaw oxlimpikvduhnaw 1994 oxlimpikeyawchnvdurxn 2010 oxechiyeniy phuich Pubat aemaebb 2008 Summer Olympics NOCs aemaebb ASM dukarechuxmoyngmayngiflniephimetim karichiflkhamokhrngkar wikixuntxipniichiflni karichbn ab wikipedia org Aҳәynҭkarrakәa rsia Ashablon Abiraҟdyrga Amerikatәi Samoa karichbn af wikipedia org Lys van hoofstede Lys van lande volgens bevolking Stille Oseaan Lys van lande volgens bevolkingsdigtheid Samoaanse nasionale rugbyspan Tongaanse nasionale rugbyspan Lys van lande Lys van internasionale rugbyspanne Sjabloon Landdata Amerikaans Samoa Lys van lande volgens BBP koopkragpariteit per capita Lys van lande volgens oppervlak Olimpiese Somerspele 2008 Olimpiese Somerspele 2012 Olimpiese Somerspele 2004 Olimpiese Somerspele 2000 Olimpiese Somerspele 1996 Olimpiese Somerspele 1992 Olimpiese Somerspele 1988 Olimpiese Somerspele 2016 Olimpiese Winterspele 1994 Oseanie Lys van lande volgens lewensverwagting Lys van lande volgens kuslynlengte Lys van IOK landkodes Lys van afhanklike gebiede Olimpiese Somerspele 2020 Vlag van die Verenigde State as Amerikaans Samoa Kategorie Amerikaans Samoa Pago Pago Eilandgebiede van die Verenigde State van Amerika OFC Polinesie Olimpiese Winterspele 2022 Samoa eilande Vlae van Oseanie Vlag van Amerikaans Samoa Samoaans Covid 19 pandemie Sjabloon Koronaviruspandemie van 2019 2020 Sjabloon Koronaviruspandemie van 2019 2020 sandput Oseanie Rugby karichbn als wikipedia org Wikipedia Landervorlagen mit Flagge Vorlage US AS Ozeanien Pazifikspiele Amerikanisch Samoa dukarichkhamokhrngkarephimetimkhxngiflnikhxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnnkhwamkwang1000khwamsung500