ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkar khxmulekiywkbphaphkhnadkhxngtwxyangni 609 600 phikesl khwamlaexiydxun 244 240 phikesl 487 480 phikesl 780 768 phikesl 1 040 1 024 phikesl 2 080 2 048 phikesl 2 563 2 524 phikesl duphaphthimikhwamlaexiydsungkwa 2 563 2 524 phikesl khnadifl 2 75 emkaibt chnidimm image jpeg rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid khwamyx phaphni idrbkarprbaetngphaph sunghmaykhwamwacaidrbkarepliynaeplngphaphtangcaktnchbb karprbprung Improved contrast using levels khaxthibayFieldsMedalBack jpg English Photo of the reverse of a Fields Medal made by Stefan Zachow for the International Mathematical Union IMU The latin prhase states Congregati ex toto orbe mathematici ob scripta insignia tribuere Espanol Fotografia del reverso de la Medalla Fields hecha por Stefan Zachow para la Union Internacional de Matematica Francais Photographie du revers de la medaille Fields faite par Stefan Zachow pour l Union mathematique internationale العربية صورة لظهر ميدالية فيلدز صنعها ستيفان زاشو للاتحاد الدولي للرياضيات IMU تنص العبارة اللاتينية تمنح لعلماء الرياضيات من جميع أنحاء العالم بسبب كتاباتهم وإسهاماتهم المميزة The photo carries no copyright and may be freely used for publications IMU requests though that Stefan Zachow s authorship is duly acknowledged Source The International Mathematical Union with more detailed information about copyright at an image description page there wnthi 22 mithunayn ph s 2550 original upload date aehlngthima File Back tifphusrangsrrkh Stefan Zachow of the International Mathematical Union retouched by King of Heartskarxnuyat karichiflniihm Released into the public domain by the author nikhuxphaphkhdsrrinwikiphiediyphasaxngkvs Featured pictures aela khux thuxwaepn phaphxyangidxyanghnungthidithisud thakhidwaiflnikhwrcaihkhwamsakhykbwikimiediykhxmmxnsepnxyangdi xyalngelthica esnxchux hakkhunmiphaphthimikhunphaph khlaykhlungkn thicasamarthephyaephridtam syyaxnuyatthiehmaasm ihaenicwa khunid xpohld kahndsyyaxnuyat aelaid esnxchuxaelw karxnuyatichsiththi Public domain Public domain false falsenganniidthukephyaephrsusatharnsmbtiodyecakhxng Stefan Zachow sungmiphlthwolk inbangpraeths karkrathadngklawxacimsamarththaidtamkdhmay Stefan Zachow xnuyatihthukkhnmisiththiinkarichiflniinthukehtuphlkarich odyimmimienguxnikh ewnaetkdhmayimxnuyatihthaechnnn Public domain Public domain false falseThis file which was originally posted to File Back tif was reviewed on 31 August 2014 by reviewer Natuur12 who confirmed that it was available there under the stated license on that date This is one of the images forming part of the Valued image set Fields Medal on Wikimedia Commons The image set has been assessed under the valued image set criteria and is considered the most valued set on Commons within the scope Fields medal You can see its nomination at Commons Valued image candidates Fields Medal khabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixairixethmthiaesdngxyuiniflniprakxbdwysthanalikhsiththicopyrighted dedicated to the public domain by copyright holder xngkvssyyaxnuyatreleased into the public domain by the copyright holder xngkvsbnthukphaphdwyPentax K10D xngkvswnthisrang wnkxtng22 mithunayn 2007 prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann wnthi ewlarupyxkhnadphuichkhwamehnpccubn01 09 21 singhakhm 25532 563 2 524 2 75 emkaibt King of Heartsdownloaded high res TIFF from http www mathunion org o General Prizes Fields pictures Front tif exposure 0 415037 to match exposure of front photo levels adjustment white point 23902 57 23 mithunayn 2550197 194 8 kiolibt Information Description The photos of the Fields Medal this is the one Grigori Perelman did not accept were made by Stefan Zachow ZIB The photos carry no copyright and may be freely used for publications IMU requests though that Stefan Zachow hnathimiphaphni hnatxipni oyngmathiphaphni ehriyyfilds karichiflkhamokhrngkar wikixuntxipniichiflni karichbn af wikipedia org Fields medalje karichbn ar wikipedia org ميدالية فيلدز karichbn ast wikipedia org Medaya Fields karichbn as wikipedia org ফ ল ডছ ম ড ল karichbn az wikipedia org Filds medali karichbn be wikipedia org Fildsayskaya premiya karichbn bg wikipedia org Fildsov medal karichbn cy wikipedia org Medal Fields karichbn de wikipedia org Fields Medaille Grigori Jakowlewitsch Perelman karichbn el wikipedia org Metallio Filnts karichbn en wikipedia org Fields Medal Wikipedia WikiProject Mathematics Recognized content Wikipedia Featured pictures thumbs 23 Wikipedia Featured pictures Sciences Mathematics Wikipedia Featured picture candidates August 2010 Wikipedia Featured picture candidates Fields Medal User talk King of Hearts Archive 2010 08 User Vietnamesepresident Portal Mathematics Recognized content karichbn es wikipedia org Medalla Fields karichbn eu wikipedia org Fields Domina karichbn fa wikipedia org مدال فیلدز karichbn fr wikipedia org Medaille Fields Prix Nobel de physiologie ou medecine Prix Nobel de la paix Prix Nobel de chimie Prix Nobel de litterature Prix de la Banque de Suede en sciences economiques en memoire d Alfred Nobel Prix Nobel de physique Prix Turing Prix Abel Prix Pritzker Prix Wolf Categorie Prix Nobel Categorie Medaille Fields Prix Crafoord Prix Nevanlinna Medaille John Bates Clark Prix Godel Etalon de Yennenga Right Livelihood Award Prix Sakharov Prix Rafto Prix Carl Friedrich Gauss Prix Polar Music Prix mondial de la liberte de la presse Prix Bruno Kreisky Prix Olof Palme Prix Albert Lasker dukarichkhamokhrngkarephimetimkhxngiflnikhxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnnphuphlitklxngPENTAX CorporationrunkhxngklxngPENTAX K10Dewlaepidhnaklxng1 45 winathi 0 022222222222222 khaexff 16xtrakhwamerw ISO400ewlathibnthukphaph13 04 27 phvsphakhm 2550khwamyawofkselns100 mm khwamkwang2 563 phikeslkhwamsung2 524 phikeslrupaebbkarbibxdLZWphikeslkhxmophsichnRGBkarcdwangphaphpkticanwnkhxmophennt3khwamlaexiydaenwnxn240 dpikhwamlaexiydaenwtng240 dpikarcderiyngkhxmulrupaebbchngkisxftaewrthiichAdobe Photoshop CS5 Windowsaekikhphaphlasud10 59 20 singhakhm 2553opraekrmexksophechxrkahndrurbaesngepnhlk a khwamerwchtetxr5 491853kharurbaesng A 8karchdechyaesng0ohmdkarwdaesngesnetxraeflchimichaeflch rangbichaeflchsepssiimidprbethiybrayaofksinfilm 35 mm 150 mm