ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkar khxmulekiywkbphaphkhnadkhxngtwxyangni 582 600 phikesl khwamlaexiydxun 233 240 phikesl 466 480 phikesl 720 742 phikesl duphaphthimikhwamlaexiydsungkwa 720 742 phikesl khnadifl 72 kiolibt chnidimm image jpeg rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid khwamyx khaxthibayDalai Lama boy jpg English 14th Dalai Lama at his enthronement ceremony February 22 1940 in Lhasawnthi 22 kumphaphnth ph s 2482aehlngthima en Image Dalai Lama boy jpg by en User Jiangphusrangsrrkh Unknown authorUnknown author karxnuyatichsiththi Public domain Public domain false falseThis work is in the public domain in India because its term of copyright has expired The Indian Copyright Act applies in India to works first published in India According to the Indian Copyright Act 1957 as amended up to Act No 27 of 2012 Chapter V Section 25 Anonymous works photographs cinematographic works sound recordings government works and works of corporate authorship or of international organizations enter the public domain 60 years after the date on which they were first published counted from the beginning of the following calendar year i e as of 2024 works published prior to 1 January 1964 are considered public domain Posthumous works other than those above enter the public domain after 60 years from publication date counted from the beginning of the following calendar year Any kind of work other than the above enters the public domain 60 years after the author s death or in the case of a multi author work the death of the last surviving author counted from the beginning of the following calendar year Text of laws judicial opinions and other government reports are free from copyright The Indian Copyright Act 1957 is not retroactive so any work in which copyright did not subsist when it commenced did not have its copyright restored and is in the public domain per the Copyright Act 1911 nxkcaknikhunxactxngephimpaysatharnsmbtiinshrthxemrika ephuxrabuwaehtuidngannicungepnsatharnsmbtiinshrthxemrika oprdthrabwangannixacimepnsatharnsmbtiinpraethsthiimidichkdrayaewlakhumkhrxnglikhsiththithisnkwa aelamikhxkahnddanlikhsiththithiyawnankwaxayukhxngphusrangsrrkhbwkipxik 60 pi odyechphaapraethsemksiok 100 pi caemka 95 pi okhlxmebiy 80 pi kwetmalaaelasamw 75 pi switesxraelndaelashrthxemrika 70 pi العربي ة ব ল Deutsch English francais ह न द italiano 日本語 ಕನ ನಡ makedonski മലയ ള मर ठ Nederlands portugues do Brasil sicilianu தம ழ ತ ಳ اردو 繁體中文 khabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixairixethmthiaesdngxyuiniflniprakxbdwywnthisrang wnkxtng22 kumphaphnth 1940media type xngkvsimage jpegchecksum xngkvsf69fb4be54fe7c3b0e89463b5d7ec69cbec0e832withikarkahnd SHA 1 xngkvsdata size xngkvs73 698 ibtkhwamsung742 phikeslkhwamkwang720 phikesl prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann wnthi ewlarupyxkhnadphuichkhwamehnpccubn09 39 31 minakhm 2549720 742 72 kiolibt fixed perspective resized08 53 31 minakhm 2549360 500 39 kiolibt HenryLi14th Dalai Lama at young From en Image Dalai Lama boy jpg by en Jiang PD China hnathimiphaphni hnatxipni oyngmathiphaphni thiebt kh s 1912 1951 karichiflkhamokhrngkar wikixuntxipniichiflni karichbn af wikipedia org Dalai Lama karichbn als wikipedia org Tenzin Gyatso Vorlage Houptsyte 22 02 22 Februar karichbn ast wikipedia org Reinu del Tibet karichbn azb wikipedia org او ن دؤردونجو دالایی لامای karichbn az wikipedia org XIV Dalay Lama karichbn ba wikipedia org Dalaj lama XIV karichbn bo wikipedia org བས ན འཛ ན ར མཚ karichbn ca wikipedia org Regne del Tibet karichbn cs wikipedia org Tandzin Gjamccho Sedm let v Tibetu film Tibet 1912 1951 karichbn cy wikipedia org Kundun karichbn da wikipedia org Kundun Tibet 1912 1950 karichbn de wikipedia org Tenzin Gyatso 22 Februar karichbn en wikipedia org Tibet 1912 1951 karichbn en wikiquote org Tenzin Gyatso 14th Dalai Lama karichbn eo wikipedia org Tenzin Gyatso Avalokiteŝvaro karichbn es wikipedia org Kundun Reino del Tibet karichbn eu wikipedia org Kundun karichbn fa wikipedia org چهاردهمین دالایی لاما karichbn fr wikipedia org 1940 Tenzin Gyatso Utilisateur Redacteur Tibet Citations du Dalai Lama Utilisateur Redacteur Tibet Brouillon karichbn ga wikipedia org 1940 karichbn gl wikipedia org Tenzin Gyatso karichbn ha wikipedia org Kundun karichbn he wikipedia org טנזין גיאטסו משתמש פכידרם ארגז חול karichbn hu wikipedia org Tendzin Gyaco karichbn hy wikipedia org Դալայ լամա XIV karichbn is wikipedia org Lama karichbn it wikipedia org Tenzin Gyatso Atman buddismo Tibet Stato karichbn ja wikipedia org 7月6日 ダライ ラマ14世 チベット 1912 1950 チベットの歴史 karichbn ka wikipedia org XIV დალაი ლამა karichbn km wikipedia org សម ត ច Dalai Lama ទ 14 karichbn ko wikipedia org 제14대 달라이 라마 쿤둔 karichbn ksh wikipedia org Tenzin Gyatso dukarichkhamokhrngkarephimetimkhxngiflnikhxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnn error0