ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkar khxmulekiywkbphaphkhnadkhxngtwxyangni 483 600 phikesl khwamlaexiydxun 193 240 phikesl 387 480 phikesl 618 768 phikesl 825 1 024 phikesl 1 801 2 236 phikesl duphaphthimikhwamlaexiydsungkwa 1 801 2 236 phikesl khnadifl 672 kiolibt chnidimm image png rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid khwamyx khaxthibayContrast in dead space between syringe designs png English Fluid remaining after plunger is fully depressed wnthi ph s 2553 aehlngthima Modeling the effect of high dead space syringes on the human immunodeficiency virus HIV epidemic among injecting drug users phusrangsrrkh Dr William Zule karxnuyatichsiththi Public domain Public domain false false This file is in the public domain because from a peer reviewed article created by myself This template must not be used to dedicate an uploader s own work to the public domain CC0 should be used instead This work must carry justifications for free usability in both the United States and its country of origin pumkarxpohldtnchbb naekhacak en wikipedia mayngkhxmmxns odyich For the Common GoodThe original description page was here All following user names refer to en wikipedia wnthi ewla khnad phuich khwamehn 15 47 11 June 2013 1 801 2 236 687 922 bytes w en Sateirti khuy swnrwm Uploading a public domain item using Wikipedia File Upload Wizard File Upload Wizard khabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixairraykarthiaesdngxyuiniflniprakxbdwywnthisrang wnkxtng2010media type nbsp xngkvsimage pngchecksum nbsp xngkvs7765c169c293d3036029e9c6e2b31e3f06a3f66cwithikarkahnd SHA 1data size nbsp xngkvs687 922 ibtkhwamsung2 236 phikeslkhwamkwang1 801 phikesl prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann wnthi ewlarupyxkhnadphuichkhwamehn pccubn17 06 5 phvsphakhm 25581 801 2 236 672 kiolibt SameeTransferred from en wikipedia see original upload log above hnathimiphaphni hnatxipni oyngmathiphaphni krabxkchidyachnidprimankhngkhanginhwekhmaelaplayhlxdchidyata karichiflkhamokhrngkar wikixuntxipniichiflni karichbn de wikipedia org Spritze Medizin karichbn en wikipedia org Low dead space syringe karichbn fr wikipedia org Tozinamerankhxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnnkhwamlaexiydaenwnxn37 79 dpckhwamlaexiydaenwtng37 79 dpc ekhathungcak https th wikipedia org wiki ifl Contrast in dead space between syringe designs png