ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkar khxmulekiywkbphaphkhnadkhxngtwxyangni 800 533 phikesl khwamlaexiydxun 320 213 phikesl 640 427 phikesl 1 024 683 phikesl 1 280 853 phikesl 2 560 1 707 phikesl 4 135 2 757 phikesl duphaphthimikhwamlaexiydsungkwa 4 135 2 757 phikesl khnadifl 6 43 emkaibt chnidimm image jpeg rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid khwamyx khaxthibayCervus elaphus Luc Viatour 6 jpg Francais Cervus elaphuswnthi 17 knyayn ph s 2554aehlngthima ngankhxngtwphusrangsrrkh Lviatour taaehnngthitngklxng50 07 14 54 ehnux 5 12 30 35 tawnxxk phaphniaelaphaphxun n sthanthiediywknthi OpenStreetMap50 120705 5 208430Camera Model Nikon D3sLens Nikon 600mm F4 AF S VRFocal length 600mmkarxnuyatichsiththi This image is the work of Luc Viatour Please credit it with Luc Viatour https Lucnix be in the immediate vicinity of the image A link to my website https lucnix be is much appreciated but not mandatory An email to Viatour Luc would be appreciated too Do not copy this image illegally by ignoring the terms of the license below as it is not in the public domain If you would like special permission to use license or purchase the image please contact me Viatour Luc to negotiate terms More free pictures in my personal gallerykhapheca inthanaphuthuxlikhsiththikhxngphaphhruxsuxni xnuyatihichphaphhruxsuxniphayitenguxnikhtxipni iflnixyuphayitsyyaxnuyat khriexthifkhxmmxns aebbaesdngthima xnuyataebbediywkn 3 0 tnchbbkhunsamarth thicaaebngpn thicathasaena aeckcay aelasngngandngklawtxip thicaeriyberiyngihm thicaddaeplngngandngklaw phayitenguxnikhtxipni aesdngthima khuntxngihekiyrtiecakhxngnganxyangehmaasm odyephimlingkipyngsyyaxnuyat aelarabuhakmikarepliynaeplng khunxacthaechnniidinrupaebbidkidtamkhwr aettxngimichinlksnathiaenawaphuihxnuyatsnbsnunkhunhruxkarichngankhxngkhun xnuyataebbediywkn hakkhunddaeplng epliynrup hruxtxetimnganni khuntxngichsyyaxnuyataebbediywknhruxaebbthiehmuxnkbsyyaxnuyatthiichkbnganniethannhttps creativecommons org licenses by sa 3 0 CC BY SA 3 0 Creative Commons Attribution Share Alike 3 0 true truekhabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixairxngkvsRed deer Cervus elaphus ixethmthiaesdngxyuiniflniprakxbdwykwangaedngphusrangbangkhathiimmiixethmwikisnethsyuxaraexl https commons wikimedia org wiki User Lviatourchuxphusrangsrrkh Lviatourchuxphuichwikimiediy Lviatourhnathikhxngwtthuphayitpraphcnni changphaphsthanalikhsiththimilikhsiththisyyaxnuyatCreative Commons Attribution ShareAlike 3 0 Unported xngkvswnthisrang wnkxtng17 knyayn 2011thimakhxngiflkarsrangdngedimodyphuxpohldbnthukphaphdwyNikon D3S xngkvscoordinates of the point of view xngkvs50 7 14 538 N 5 12 30 348 Eexposure time xngkvs0 0015625 winathif number xngkvs4focal length xngkvs600 milliemtrISO speed xngkvs500media type xngkvsimage jpegepnphaphthaychecksum xngkvsfbfb6aebf3d469c163b030d236cb23cd26e637afwithikarkahnd SHA 1 xngkvsdata size xngkvs6 743 433 ibtkhwamsung2 757 phikeslkhwamkwang4 135 phikesl prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann wnthi ewlarupyxkhnadphuichkhwamehnpccubn14 32 19 knyayn 25544 135 2 757 6 43 emkaibt hnathimiphaphni hnatxipni oyngmathiphaphni praethsednmark karichiflkhamokhrngkar wikixuntxipniichiflni karichbn ar wikipedia org أيل جنس قائمة أضخم الأيليات karichbn arz wikipedia org الايل الاحمر جنس الايل karichbn ast wikipedia org Cervus elaphus karichbn avk wikipedia org Wocol Cervus elaphus karichbn az wikipedia org Necib maral Esl maral karichbn bg wikipedia org Blagoroden elen Eleni karichbn ca wikipedia org Cervol comu Cervus Mata de Valencia karichbn ca wiktionary org cervol karichbn cy wikipedia org Carw coch karichbn da wikibooks org Danmarks forhistoriske bebyggelse karichbn de wikipedia org Europa Rothirsch Liste der Saugetiere Osterreichs Benutzer Alfrejg Edelhirsche Tiere im Wienerwald karichbn de wiktionary org Rothirsch karichbn en wikipedia org Red deer Rold Skov List of mammals of Florida List of artiodactyls User HarJIT List of the Cenozoic life of Alabama List of the Cenozoic life of Georgia U S state List of the Cenozoic life of Colorado User Naldo Crocoduck Mammals Largest cervids User Abyssal Image captions to use User Abyssal Aspect ratio table Forest of Orleans Atlantic mixed forests List of cervids Wikipedia Wikipedia Signpost 2021 06 27 Traffic report User The0Quester Gallery Animals Wikipedia Top 25 Report June 6 to 12 2021 Wikipedia Top 25 Report June 13 to 19 2021 Wikipedia Wikipedia Signpost Single 2021 06 27 User The0Quester Gallery Animals per Continent User Esagurton Animals List of mammals of Montenegro karichbn eo wikipedia org Kastelo de Chambord karichbn eo wiktionary org cervo karichbn eu wikipedia org Zerrenda Euskal Herriko ugaztunak Orein arrunt karichbn fa wikipedia org مرال dukarichkhamokhrngkarephimetimkhxngiflnikhxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnnphuphlitklxngNIKON CORPORATIONrunkhxngklxngNIKON D3SphuthrnglikhsiththiWWW LUCNIX BEewlaepidhnaklxng1 640 winathi 0 0015625 khaexff 4xtrakhwamerw ISO500ewlathibnthukphaph11 19 17 knyayn 2554khwamyawofkselns600 mm radbkhwamsungcaknathaelehnuxradbnathael 190 emtrkhwamlaexiydaenwnxn300 dpikhwamlaexiydaenwtng300 dpisxftaewrthiichBibble Pro 5 5 2 2aekikhphaphlasud23 13 17 knyayn 2554opraekrmexksophechxrkahndrurbaesngepnhlk a ewlathiaeplngepndicithl11 19 17 knyayn 2554rurbaesngkwangsud4 APEX f 4 ohmdkarwdaesngaephtethirnaesngimthrabaeflchimichaeflchesiywwinathi wnthi ewla142esiywwinathi wnthi ewlatnchbb790esiywwinathi wnthi ewlathidiciiths790ohmdexksophechxrexksophechxrxtonmtiiwtbalansiwtbalansxtonmtirayaofksinfilm 35 mm 600 mm chnidsinaekhpecxrpktikhwamepribbtangpktikhwamximsipktikhwamkhmhardrayahangwtthuimthrablaticudehnuxhruxitlaticudehnuxlxngcicudtawnxxkhruxtawntklxngcicudtawnxxkcanwndawethiymthiichwdkha08wnthiciphiexs17 knyayn 2554