ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkar khxmulekiywkbphaphkhnadkhxngtwxyangni 800 533 phikesl khwamlaexiydxun 320 213 phikesl 640 427 phikesl 1 024 683 phikesl 1 280 853 phikesl 3 000 2 000 phikesl duphaphthimikhwamlaexiydsungkwa 3 000 2 000 phikesl khnadifl 1 11 emkaibt chnidimm image jpeg rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid khwamyx khaxthibayCanadian Forces Browning Hi Power jpg English Canadian soldiers of Alpha Company 3rd Battalion Royal 22e Regiment Canadian Army inspect their weapons prior to participating in lane training during a training evolution on Camp Blanding Fla April 18 2009 in support of Partnership of the Americas 2009 U S Marines with 24th Marine Regiment are training with service members from Brazil Chile Colombia Mexico Peru Uruguay and Canada in support of the multinational and multiservice exercise designed to enhance regional security and interoperability with maritime partners wnthi 18 emsayn ph s 2552aehlngthima http www defenseimagery mil imagery html guid bd1685053020682afc1d1c64859f6491a26e5da3phusrangsrrkh Lance Cpl Christopher J Gallagher karxnuyatichsiththi Public domain Public domain false falseThis file is a work of a United States Marine or employee taken or made as part of that person s official duties As a work of the U S federal government it is in the public domain العربية ব ল catala Deutsch English espanol francais magyar italiano 日本語 makedonski മലയ ള မ န မ ဘ သ Nederlands portugues russkij sicilianu slovenscina svenska Turkce ukrayinska Tiếng Việt 中文 简体 中文 繁體 pumkarxpohldtnchbb The original description page was here All following user names refer to en wikipedia 2009 06 09 13 18 Koalorka 3000 2000 1160422 bytes Information Description Canadian soldiers of Alpha Company 3rd Battalion 22nd Regiment Canadian Royal Army inspect their weapons prior to participating in lane training during a training evolution on Camp Blanding Fla April 18 2009 in supkhabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixairixethmthiaesdngxyuiniflniprakxbdwywnthisrang wnkxtng18 emsayn 2009bnthukphaphdwyCanon EOS 1D Mark III xngkvsmedia type xngkvsimage jpegchecksum xngkvsdf1346a3127034ab42192f8a3e193fe4d9380bc4withikarkahnd SHA 1 xngkvsdata size xngkvs1 160 422 ibtkhwamsung2 000 phikeslkhwamkwang3 000 phikesl prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann wnthi ewlarupyxkhnadphuichkhwamehnpccubn07 24 7 tulakhm 25533 000 2 000 1 11 emkaibt Sanandros Information Description en Canadian soldiers of Alpha Company 3rd Battalion Royal 22 lt sup gt e lt sup gt Regiment Canadian Army inspect their weapons prior to participating in lane training during a training evolution on Camp Blanding Fla April 18 20 hnathimiphaphni hnatxipni oyngmathiphaphni brawning ih phawewxr karichiflkhamokhrngkar wikixuntxipniichiflni karichbn ar wikipedia org براوينغ هاي باور karichbn en wikipedia org Browning Hi Power Primary Reserve karichbn es wikipedia org Ejercito Canadiense karichbn fr wikipedia org Browning 9 mm karichbn ja wikipedia org 戦闘服 karichbn pt wikipedia org Browning Hi Power karichbn www wikidata org Q2926341 Wikidata WikiProject Fashion To Do Clothing list karichbn zh wikipedia org 白朗寧大威力半自動手槍khxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnnchuxphaphCanadian soldiers of Alpha Company 3rd Battalion 22nd Regiment Canadian Royal Army inspect their weapons prior to participating in lane training during a training evolution on Camp Blanding Fla April 18 2009 in support of Partnership of the Americas 2009 U S Marines with 24th Marine Regiment are training with service members from Brazil Chile Colombia Mexico Peru Uruguay and Canada in support of the multinational and multiservice exercise designed to enhance regional security and interoperability with maritime partners U S Marine Corps photo by Lance Cpl Christopher J Gallagher Released phuphlitklxngCanonrunkhxngklxngCanon EOS 1D Mark IIIewlaepidhnaklxng1 400 winathi 0 0025 khaexff 7 1xtrakhwamerw ISO100ewlathibnthukphaph16 44 17 emsayn 2552khwamyawofkselns70 mm karcdwangphaphpktikhwamlaexiydaenwnxn300 dpikhwamlaexiydaenwtng300 dpisxftaewrthiichAdobe Photoshop CS3 Windowsaekikhphaphlasud00 00 18 emsayn 2552taaehnng Y aela CCo sitedopraekrmexksophechxrtngkhaexngrunexksif Exif 2 21ewlathiaeplngepndicithl00 00 18 emsayn 2552khwamerwchtetxr8 625kharurbaesng A 5 625karchdechyaesng0ohmdkarwdaesngaephtethirnaeflchimichaeflch rangbichaeflchesiywwinathi wnthi ewla77esiywwinathi wnthi ewlatnchbb77esiywwinathi wnthi ewlathidiciiths77sepssisRGBkhwamlaexiydranabofks X3 512 1951219512khwamlaexiydranabofks Y3 521 7391304348hnwykhwamlaexiydranabofksniwkarpramwlphaphophlessspktiohmdexksophechxrexksophechxrtngkhaexngiwtbalansiwtbalansxtonmtichnidsinaekhpecxrpkti