ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkar khxmulekiywkbphaphkhnadkhxngtwxyang PNG nikhxngifl SVG ni 180 600 phikesl khwamlaexiydxun 72 240 phikesl 144 480 phikesl 230 768 phikesl 307 1 024 phikesl 614 2 048 phikesl 600 2 000 phikesl duphaphthimikhwamlaexiydsungkwa ifl SVG 600 2 000 phikesl khnadifl 375 ibt rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid khaxthibayBanner of Germany 1935 1945 svg Hanging banner version of the Nazi flag wnthi 28 minakhm ph s 2551aehlngthima Based on various photographsphusrangsrrkh phaphhruxsuxnikhadkhxmulekiywkb phusrangsrrkhphlngankarxnuyat karichiflniihm According to 5 Abs 1 of the German Copyright law official works like coats of arms are gemeinfrei in the public domain However please be aware Depending on context the use of this flag is banned or even illegal in Germany Austria Hungary Poland Czech Republic France Brazil and other countries by other laws beyond copyright for details please see below ColorsInfoFieldichsi sida rendered as RGB span style visibility hidden 00 span 0 span style visibility hidden 00 span 0 span style visibility hidden 00 span 0 sikhaw rendered as RGB 255 255 255 siaedng rendered as RGB 221 span style visibility hidden 00 span 0 span style visibility hidden 00 span 0Nazi Flag German Reich Color SchemeSVGInfoFieldi sxrsokhdkhxng SVG nitrwcsxbthuktxngaelw iflphaphewketxrni srangkhunodyichopraekrmaekikhkhxkhwam Public domain Public domain false falseThis file depicts the flag of a German Korperschaft des offentlichen Rechts corporation governed by public law According to 5 Abs 1 of the GermanCopyright law official workslike flags aregemeinfrei in the public domain Note The usage of flags is governed by legal restrictions independent of the copyright status of the depiction shown here Wappen Deutschlands khaptiesthkhwamrbphid aelakhxkhwrrawngekiywkbkdhmay phaphniepnphaphekhruxnghmaythangkar hruxepnphaphthikhlaykbekhruxnghmaythangkar khxngrthbalsngkhmniymaehngchatieyxrmni nasi hruxxngkhkrthiekiywkhxngxun echn ekhruxnghmayswstika hruxekhruxnghmaykangekhnsr sungsalrththrrmnuyaehngshphnthsatharnrtheyxrmni idprakaskhaphiphaksaihpranamtrani inthanasuxaehngkhwamrunaerngaelakhwamirmnusythrrmkhxngxdxlf hitelxr phrxmphwk thungaemwakarichaela hruxaesdngekhruxnghmaydngklaw caepnkarkrathathikhdtxbthbyytiaehngkdhmayinhlaypraeths idaek eyxrmni xxsetriy hngkari opaelnd echkekiy frngess brasil aelapraethsxun thimibthbyytipxngpramkaraesdngekhruxnghmaythangkarkhxngrthbalsngkhmniymaehngchatieyxrmni aelamiidklawthungiwinthini aetwtthuprasngkhkhxngkarxpohldphaphinwikimiediykhxmmxnsni ephuxichpraoychnthangkarsuksaaelaihkhxmulepnsakhy miidmiectnaplukpnihekidkhwamaetkaeykinchatiphuidrbkhwamesiyhaycakrthbalsngkhmniymaehngchatieyxrmnikhabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixairxngkvsBanner of Germany 1935 1945 eyxrmnBanner Deutschlands 1935 1945 lkesmebirkBanner vun Daitschland 1935 1945 dtchBanner van Duitsland 1935 1945 ixethmthiaesdngxyuiniflniprakxbdwywnthisrang wnkxtng28 minakhm 2008media type xngkvsimage svg xmlchecksum xngkvs48b8bb15cddd53042dcb2ce789c0f47b3882cbc0withikarkahnd SHA 1 xngkvsdata size xngkvs375 ibtkhwamsung2 000 phikeslkhwamkwang600 phikesl prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann wnthi ewlarupyxkhnadphuichkhwamehnpccubn07 12 19 knyayn 2554600 2 000 375 ibt code cleanup10 32 29 minakhm 2551600 2 000 3 kiolibt Information Description Hanging banner version of the Nazi flag Source Based on various photographs Date March 28 2008 Author Permission According to 5 Abs 1 of the German Copyright law official works like coats of arms are gemeinfrei in hnathimiphaphni hnatxipni oyngmathiphaphni raykarthnginpraethseyxrmni raychuxthngeruxinnasieyxrmni karichiflkhamokhrngkar wikixuntxipniichiflni karichbn ar wikipedia org قائمة أعلام ألمانيا karichbn en wikipedia org List of German flags karichbn fa wikipedia org فهرست پرچم های آلمان karichbn ja wikipedia org ドイツの旗一覧 karichbn ko wikipedia org 아돌프 히틀러 헤르만 괴링 하인리히 힘러 요제프 괴벨스 히틀러 내각 루돌프 헤스 마르틴 보어만 요아힘 폰 리벤트로프 빌헬름 카이텔 알프레트 로젠베르크 빌헬름 프리크 아르투어 자이스잉크바르트 한스 프랑크 프란츠 젤테 프리츠 토트 틀 히틀러 내각 프란츠 귀르트너 베른하르트 루스트 헤르베르트 바케 루츠 그라프 슈베린 폰 크로지크 리하르트 발터 다레 에른스트 룀 알베르트 슈페어 오토 게오르크 티라크 오토 마이스너 발터 풍크 알프레트 후겐베르크 프란츠 폰 파펜 얄마르 샤흐트 분류 나치 독일의 각료 콘스탄틴 폰 노이라트 대중계몽선전국가부 베르너 폰 블롬베르크 한스 라머스 karichbn mr wikipedia org जर मन च ध वज karichbn pt wikipedia org Adolf Hitler Nazismo Karl Donitz Joseph Goebbels Fuhrer Adolf Eichmann Julius Streicher Dietrich Eckart Sociedade Thule Heinrich Himmler Josef Mengele dukarichkhamokhrngkarephimetimkhxngiflnikhxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnnkhwamkwang600khwamsung2000