ifl prawtiifl hnathimiphaphni khxmulekiywkbphaphkhnadkhxngtwxyangni 800 533 phikesl khwamlaexiydxun 320 213 phikesl 640 427 phikesl 1 024 683 phikesl 1 280 853 phikesl 2 560 1 707 phikesl 5 472 3 648 phikesl duphaphthimikhwamlaexiydsungkwa 5 472 3 648 phikesl khnadifl 1 26 emkaibt chnidimm image jpeg rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid khwamyx khaxthibay1st SFG A Balance Torch 17 7 Image 1 of 6 jpg English Royal Thai Army Special Forces Counter Terrorist Operations Center and U S Soldiers 1st Battalion 1st Special Forces Group Airborne conducts fast rope training at Lob Buri Thailand July 25 2017 as part of Balance Torch 17 7 The trainings is to test the Soldiers through a series of challenges culminating into a final marksmanship competition and a culmination exercise U S Army photo by Staff Sgt Kwadwo Frimpong Released wnthi 24 krkdakhm ph s 2560 20 00 00aehlngthima https www dvidshub net image 3688176 1st sfg balance torch 17 7phusrangsrrkh Staff Sgt Kwadwo Frimpong karxnuyatichsiththi Public domain Public domain false falseThis file is a work of a U S Army soldier or employee taken or made as part of that person s official duties As a work of the U S federal government it is in the public domain in the United States العربية ব ল catala cestina Deutsch English espanol eesti فارسی suomi francais hrvatski magyar Bahasa Indonesia italiano 日本語 한국어 lietuviu makedonski മലയ ള မ န မ ဘ သ Nederlands polski portugues russkij sicilianu srpski srpski Turkce ukrayinska Tiếng Việt 中文 简体 中文 繁體 khabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixairixethmthiaesdngxyuiniflniprakxbdwybnthukphaphdwyCanon EOS 6D xngkvsexposure time xngkvs0 005 winathif number xngkvs2 8focal length xngkvs70 milliemtrISO speed xngkvs160media type xngkvsimage jpegepnphaphthay prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann wnthi ewlarupyxkhnadphuichkhwamehnpccubn09 46 21 thnwakhm 25665 472 3 648 1 26 emkaibt AdrichUploaded a work by Staff Sgt Kwadwo Frimpong from https www dvidshub net image 3688176 1st sfg balance torch 17 7 with UploadWizard hnathimiphaphni hnatxipni oyngmathiphaphni sunyptibtikartxtankarkxkarraysakl khxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnnchuxphaphRoyal Thai Army Special Forces Counter Terrorist Operations Center and U S Soldiers 1st Battalion 1st Special Forces Group Airborne conducts fast rope training at Lob Buri Thailand July 25 2017 as part of Balance Torch 17 7 The trainings is to test the Soldiers through a series of challenges culminating into a final marksmanship competition and a culmination exercise U S Army photo by Staff Sgt Kwadwo Frimpong Released phuphlitklxngCanonrunkhxngklxngCanon EOS 6DphuthayStaff Sgt Kwadwo FrimpongphuthrnglikhsiththiPublic Domainewlaepidhnaklxng1 200 winathi 0 005 khaexff 2 8xtrakhwamerw ISO160khwamyawofkselns70 mm chuxeruxngsn170725 A YM078 030ewlathibnthukphaph20 00 24 krkdakhm 2560phadhw1st SFG A Balance Torch 17 7ekhrdit phucdetriym1st Special Forces Group AirbortnchbbDigitalemuxngthiaesdngkarcdwangphaphpktikhwamlaexiydaenwnxn240 dpikhwamlaexiydaenwtng240 dpiopraekrmexksophechxrtngkhaexngrunexksif Exif 2 3khwamerwchtetxr7 643856kharurbaesng A 2 970854karchdechyaesng0rurbaesngkwangsud3 APEX f 2 83 ohmdkarwdaesngaephtethirnaeflchimichaeflch rangbichaeflchsepssisRGBkhwamlaexiydranabofks X3 810 5849582173khwamlaexiydranabofks Y3 815 89958159hnwykhwamlaexiydranabofksniwkarpramwlphaphophlessspktiohmdexksophechxrexksophechxrtngkhaexngiwtbalansiwtbalanstngkhaexngchnidsinaekhpecxrpktirun IIM4hmwdhmuesrimUnclassifiedkhaaenanaphiessReleased Staff Sgt Kwadwo Frimpong 1st Special Forces Group Airborne kwadwo frimpong socom mil via DVIDSrhssahrbpraethsthiaesdngUSpraethsthiaesdngUnited StatesphuekhiynStaff Sgt Kwadwo FrimpongrhstaaehnngthitngkarsngdngedimtwrabuDVIDS Image ID 3688176cnghwdhruxrththiaesdng