ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkar khxmulekiywkbphaphkhnadkhxngtwxyangni 800 600 phikesl khwamlaexiydxun 320 240 phikesl 640 480 phikesl 1 024 768 phikesl 1 280 960 phikesl 2 560 1 920 phikesl 4 032 3 024 phikesl duphaphthimikhwamlaexiydsungkwa 4 032 3 024 phikesl khnadifl 2 88 emkaibt chnidimm image jpeg rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid khwamyx khaxthibayCentro civico de Boa Vista RR jpg Portugues Imagem do Centro Civico de Boa Vista Roraimawnthi 1 minakhm ph s 2562 17 06 56 tidtamkhxmul Exif aehlngthima https www flickr com photos 188077376 N02 49949568888phusrangsrrkh Dieny Portinanni Araujo Cavalcante taaehnngthitngklxng2 49 22 ehnux 60 40 25 tawntk phaphniaelaphaphxun n sthanthiediywknthi OpenStreetMap2 822778 60 673611karxnuyatichsiththi iflnimiihichphayit CC0 1 0 Universal Public Domain Dedication khxngkhriexthifkhxmmxnsThe person who associated a work with this deed has dedicated the work to the public domain by waiving all of their rights to the work worldwide under copyright law including all related and neighboring rights to the extent allowed by law You can copy modify distribute and perform the work even for commercial purposes all without asking permission http creativecommons org publicdomain zero 1 0 deed en CC0 Creative Commons Zero Public Domain Dedication false falseThis image was originally posted to Flickr by diportinanni at https flickr com photos 188077376 N02 49949568888 It was reviewed on 30 phvsphakhm ph s 2563 by FlickreviewR 2 and was confirmed to be licensed under the terms of the cc zero 30 phvsphakhm ph s 2563khabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixairixethmthiaesdngxyuiniflniprakxbdwyphusrangbangkhathiimmiixethmwikisnethschuxphusrangsrrkh Dieny Portinanni Araujo Cavalcantethukephyaephrinflikhekxrephyaephrkhrngaerk 29 phvsphakhm 2020sthanalikhsiththicopyrighted dedicated to the public domain by copyright holder xngkvssyyaxnuyatCreative Commons CC0 License xngkvsbnthukphaphdwysmsung kaaelkhsiexs 8coordinates of the point of view xngkvs2 49 22 001 N 60 40 25 000 Wwnthisrang wnkxtng1 minakhm 2019exposure time xngkvs0 00121654501216545012 winathif number xngkvs1 7focal length xngkvs4 2 milliemtrISO speed xngkvs40epnphaphthaythimakhxngiflfile available on the internet xngkvsxthibayin URL https www flickr com photos 188077376 N02 49949568888 phudaeninkar flikhekxryuxaraexl https live staticflickr com 65535 49949568888 18d1a2e294 o jpgmedia type xngkvsimage jpegchecksum xngkvsffa8b4e6654aa5ab5d2ea4479de1d99eefba6e1fwithikarkahnd 0702186578 xngkvsdata size xngkvs3 017 145 ibtkhwamsung3 024 phikeslkhwamkwang4 032 phikesl Flickr photo ID xngkvs49949568888 prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann wnthi ewlarupyxkhnadphuichkhwamehnpccubn01 49 31 phvsphakhm 25634 032 3 024 2 88 emkaibt Allice HunterAdjustment10 45 5 phvsphakhm 25634 032 3 024 1 66 emkaibt Allice HunterUploaded a work by Piqsels from https www piqsels com en public domain photo ohhoq with UploadWizard hnathimiphaphni immihnaidoyngmathiphaphnikarichiflkhamokhrngkar wikixuntxipniichiflni karichbn es wikipedia org Roraima karichbn hy wikipedia org Բոա Վիստա Ռորայմա karichbn pt wikipedia org Roraima Boa Vista Roraima khxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnnphuphlitklxngsamsungrunkhxngklxngSM G950Fewlaepidhnaklxng1 822 winathi 0 0012165450121655 khaexff 1 7xtrakhwamerw ISO40ewlathibnthukphaph17 06 1 minakhm 2562khwamyawofkselns4 2 mm karcdwangphaphpktikhwamlaexiydaenwnxn72 dpikhwamlaexiydaenwtng72 dpisxftaewrthiichG950FXXS4CRLBaekikhphaphlasud17 06 1 minakhm 2562taaehnng Y aela Ckungklangopraekrmexksophechxropraekrmpktirunexksif Exif 2 2ewlathiaeplngepndicithl17 06 1 minakhm 2562khwamhmaykhxngaetlakhxmophenntY Cb Cr immikhakhwamerwchtetxr9 68kharurbaesng A 1 53khwamswang APEX7 21karchdechyaesng0rurbaesngkwangsud1 53 APEX f 1 7 ohmdkarwdaesngaephtethirnaeflchimichaeflchesiywwinathi wnthi ewla0021esiywwinathi wnthi ewlatnchbb0021esiywwinathi wnthi ewlathidiciiths0021runaeflchphiksthirxngrb1sepssisRGBohmdexksophechxrexksophechxrxtonmtiiwtbalansiwtbalansxtonmtirayaofksinfilm 35 mm 26 mm chnidsinaekhpecxrpktirhsphaphF12LLJA00SM F12LLKL01GMrunciphiexsaethk0 0 0 0