ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkar khxmulekiywkbphaphkhnadkhxngtwxyangni 600 600 phikesl khwamlaexiydxun 240 240 phikesl 480 480 phikesl 768 768 phikesl 1 024 1 024 phikesl 2 300 2 300 phikesl duphaphthimikhwamlaexiydsungkwa 2 300 2 300 phikesl khnadifl 3 49 emkaibt chnidimm image jpeg rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid This is an image of a place or building that is listed on the National Register of Historic Places in the United States of America Its reference number is 66000493 khaxthibayTrinity Site Obelisk National Historic Landmark jpg English Trinity Site obelisk The black plaque on top reads Trinity Site Where The World s First Nuclear Device Was Exploded On July 16 1945 Erected 1965 White Sands Missile Range J Frederick Thorlin Major General U S Army Commanding The gold plaque below it declares the site a National Historic Landmark and reads Trinity Site has been designated a National Historical Landmark This Site Possesses National Significance In Commemorating The History of the United States of America 1975 National Park Service United States Department of the Interiorwnthi 2 tulakhm ph s 2553 12 00 57aehlngthima Flickr Trinity Site Obelisk National Historic Landmarkphusrangsrrkh Samat Jainkarxnuyat karichiflniihm This image which was originally posted to Flickr was uploaded to Commons using Flickr upload bot on 13 mkrakhm ph s 2554 14 54 by Bomazi On that date it was confirmed to be licensed under the terms of the license indicated iflnixyuphayitsyyaxnuyat khriexthifkhxmmxns aebbaesdngthima xnuyataebbediywkn 2 0 thwipkhunsamarth thicaaebngpn thicathasaena aeckcay aelasngngandngklawtxip thicaeriyberiyngihm thicaddaeplngngandngklaw phayitenguxnikhtxipni aesdngthima khuntxngihekiyrtiecakhxngnganxyangehmaasm odyephimlingkipyngsyyaxnuyat aelarabuhakmikarepliynaeplng khunxacthaechnniidinrupaebbidkidtamkhwr aettxngimichinlksnathiaenawaphuihxnuyatsnbsnunkhunhruxkarichngankhxngkhun xnuyataebbediywkn hakkhunddaeplng epliynrup hruxtxetimnganni khuntxngichsyyaxnuyataebbediywknhruxaebbthiehmuxnkbsyyaxnuyatthiichkbnganniethannhttps creativecommons org licenses by sa 2 0 CC BY SA 2 0 Creative Commons Attribution Share Alike 2 0 true true The memorial plaque itself is a work of the US Federal government See White Sands NM An Administrative History Chapter 6 Public domain Public domain false falseThis image or media file contains material based on a work of a National Park Service employee created as part of that person s official duties As a work of the U S federal government such work is in the public domain in the United States See the NPS website and NPS copyright policy for more information taaehnngthitngklxng33 40 38 13 ehnux 106 28 31 64 tawntk phaphniaelaphaphxun n sthanthiediywknthi OpenStreetMap33 677258 106 475455This image represents an Open Plaques entry 8206 khabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixaireyxrmnObelisk der Dreifaltigkeitsstatte ixethmthiaesdngxyuiniflniprakxbdwyTrinity Site xngkvssthanalikhsiththimilikhsiththisyyaxnuyatCreative Commons Attribution ShareAlike 2 0 Generic xngkvsbnthukphaphdwyCanon EOS 50D xngkvscoordinates of the point of view xngkvs33 40 38 129 N 106 28 31 638 Wwnthisrang wnkxtng2 tulakhm 2010location of creation xngkvsSocorro County xngkvsexposure time xngkvs0 004 winathif number xngkvs10focal length xngkvs20 milliemtrISO speed xngkvs100media type xngkvsimage jpegepnphaphthay prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann wnthi ewlarupyxkhnadphuichkhwamehnpccubn01 29 17 krkdakhm 25562 300 2 300 3 49 emkaibt Crop contrast21 55 13 mkrakhm 25542 530 2 530 4 09 emkaibt Uploaded from http flickr com photo 99842842 N00 5079553260 using hnathimiphaphni hnatxipni oyngmathiphaphni thriniti karichiflkhamokhrngkar wikixuntxipniichiflni karichbn af wikipedia org Obelisk karichbn ast wikipedia org Prueba Trinity karichbn ca wikipedia org Trinity assaig nuclear karichbn da wikipedia org Trinitytesten karichbn de wikipedia org Trinity Test Geschichte des Strahlenschutzes karichbn el wikipedia org Pyrhnikh dokimh Trinity karichbn en wikipedia org Trinity nuclear test List of modern obelisks Portal Nuclear technology Pictures Portal Nuclear technology Pictures 44 History of radiation protection karichbn en wikiquote org Wikiquote Quote of the day July 2015 Wikiquote Quote of the day July 16 2015 karichbn en wikivoyage org Alamogordo Nuclear tourism Golden Age of Modern Physics karichbn es wikipedia org Prueba Trinity karichbn es wikivoyage org Turismo nuclear karichbn et wikipedia org Trinity tuumakatsetus karichbn eu wikipedia org Trinity proba atomikoa karichbn fi wikipedia org Trinity ydinkoe karichbn fr wikipedia org Utilisateur Mathieudu68 Manquants National Historic Landmarks karichbn he wikipedia org ניסוי טריניטי karichbn ja wikipedia org トリニティ実験 karichbn ml wikipedia org ട ര ന റ റ അണ വ യ ധ പര ക ഷണ karichbn nl wikipedia org Trinity atoombom karichbn pt wikipedia org Experiencia Trinity karichbn ro wikipedia org Testul Trinity karichbn rue wikipedia org Alamogordo vyprobnya karichbn sr wikipedia org Triniti test karichbn sv wikipedia org Trinitytestet karichbn ta wikipedia org ட ர ன ட ட அண க ண ட ச தன karichbn uk wikipedia org Triniti viprobovuvannya karichbn vi wikipedia org Trinity vụ thử hạt nhan karichbn www wikidata org Q19842077 karichbn zh wikipedia org 三位一體 核試驗 khxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnnphuphlitklxngCanonrunkhxngklxngCanon EOS 50Dewlaepidhnaklxng1 250 winathi 0 004 khaexff 10xtrakhwamerw ISO100ewlathibnthukphaph12 00 2 tulakhm 2553khwamyawofkselns20 mm laticud33 40 38 13 Nlxngcicud106 28 31 64 Wradbkhwamsungcaknathaelehnuxradbnathael 1 475 297 emtrkhwamkwang2 530 phikeslkhwamsung2 530 phikeslkarcdwangphaphpktisxftaewrthiichdigiKam 1 4 0aekikhphaphlasud12 00 2 tulakhm 2553taaehnng Y aela CCo sitedopraekrmexksophechxrimkahndrunexksif Exif 2 21ewlathiaeplngepndicithl12 00 2 tulakhm 2553khwamhmaykhxngaetlakhxmophenntY Cb Cr immikhakhwamerwchtetxr8kharurbaesng A 6 625karchdechyaesng0ohmdkarwdaesngaephtethirnaeflchimichaeflch rangbichaeflchesiywwinathi wnthi ewla47esiywwinathi wnthi ewlatnchbb47esiywwinathi wnthi ewlathidiciiths47runaeflchphiksthirxngrb1sepssisRGBkhwamlaexiydranabofks X5 315 4362416107khwamlaexiydranabofks Y5 306 5326633166hnwykhwamlaexiydranabofksniwkarpramwlphaphophlessspktiohmdexksophechxrexksophechxrxtonmtiiwtbalansiwtbalansxtonmtichnidsinaekhpecxrpktikhxmulkarsarwccioxedtikthithukichWGS 84runciphiexsaethk2 0 0 0