ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkarkhnadkhxngtwxyangni 608 600 phikesl khwamlaexiydxun 243 240 phikesl 487 480 phikesl 779 768 phikesl 1 038 1 024 phikesl 1 530 1 509 phikesl duphaphthimikhwamlaexiydsungkwa 1 530 1 509 phikesl khnadifl 1 34 emkaibt chnidimm image png rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid khaxthibayPh seal south cotabato png Provincial seal of South Cotabato Philippines wnthi 28 knyayn ph s 2551aehlngthima en Image Ph seal south cotabato pngphusrangsrrkh originally uploaded by en User TheCoffeekarxnuyat karichiflniihm Public domain Public domain false falseThis work was first published in the Philippines and is now in the public domain because its copyright protection has expired by virtue of the Intellectual Property Code of the Philippines The work meets one of the following criteria It is an anonymous or pseudonymous work and 50 years have passed since the year of its publication It is an audiovisual or photographic work and 50 years have passed since the year of its publication It is a work of applied art and 25 years have passed since the year of its publication It is another kind of work and 50 years have passed since the year of death of the author or last surviving author Important note Works of foreign non U S origin must be out of copyright or freely licensed in both their home country and the United States in order to be accepted on Commons Works of Philippine origin that have entered the public domain in the U S due to certain circumstances such as publication in noncompliance with U S copyright formalities may have had their U S copyright restored under the Uruguay Round Agreements Act URAA if the work was under copyright in its country of origin on the date that the URAA took effect in that country For the Philippines the URAA took effect on January 1 1996 nxkcaknikhunxactxngephimpaysatharnsmbtiinshrthxemrika ephuxrabuwaehtuidngannicungepnsatharnsmbtiinshrthxemrika oprdthrabwangannixacimepnsatharnsmbtiinpraethsthiimidichkdrayaewlakhumkhrxnglikhsiththithisnkwa aelamikhxkahnddanlikhsiththithiyawnankwaxayukhxngphusrangsrrkhbwkipxik 60 pi odyechphaaxyangyingpraethsemksiok 100 pi caemka 95 pi okhlxmebiy 80 pi kwetmalaaelasamw 75 pi switesxraelndaelashrthxemrika 70 pi aelaewensuexla 60 pikhabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixairixethmthiaesdngxyuiniflniprakxbdwywnthisrang wnkxtng28 knyayn 2008media type xngkvsimage png prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann wnthi ewlarupyxkhnadphuichkhwamehnpccubn10 45 17 krkdakhm 25631 530 1 509 1 34 emkaibt Replacing this old one with the new one which is currently used by the provincial government00 24 29 knyayn 2551150 150 11 kiolibt Information Description Provincial seal of South Cotabato Philippines Source en Image Ph seal south cotabato png Date 2008 09 28 Author originally uploaded by en User TheCoffee Permission PD Philippines other versions Categor hnathimiphaphni hnatxipni oyngmathiphaphni cnghwdtiomkokhtabaot karichiflkhamokhrngkar wikixuntxipniichiflni karichbn ar wikipedia org جنوب كوتاباتو karichbn azb wikipedia org گونئی کوتاباتو karichbn bcl wikipedia org Probinsya kan Filipinas Wikipedia WikiRabuz Banwaan Plantilya South Cotabato South Cotabato karichbn cbk zam wikipedia org South Cotabato karichbn ceb wikipedia org Habagatang Cotabato Lalawigan Pilipinas karichbn en wikipedia org South Cotabato Soccsksargen List of current Philippine provincial governors Wikipedia Tambayan Philippines Task force LGU Provinces in Wikidata karichbn es wikipedia org Cotabato del Sur karichbn it wikipedia org Provincia di South Cotabato karichbn ka wikipedia org სამხრეთი კოტაბატო karichbn la wikipedia org Cotabato Australis karichbn lv wikipedia org Dienvidkotabato karichbn mk wikipedia org Pokraini na Filipinite Јuzhen Kotabato karichbn ms wikipedia org Cotabato Selatan karichbn no wikipedia org South Cotabato karichbn pag wikipedia org South Cotabato karichbn pt wikipedia org Cotabato do Sul karichbn ru wikipedia org Yuzhnyj Kotabato karichbn simple wikipedia org South Cotabato karichbn tr wikipedia org Guney Cotabato karichbn uk wikipedia org Pivdennij Kotabato karichbn ur wikipedia org جنوبی کوتاباتو karichbn vi wikipedia org Nam Cotabato karichbn war wikipedia org Pilipinhon nga lalawigan South Cotabato karichbn www wikidata org Q13882