ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkar khxmulekiywkbphaphkhnadkhxngtwxyangni 800 588 phikesl khwamlaexiydxun 320 235 phikesl 640 470 phikesl 1 024 753 phikesl 1 280 941 phikesl 2 560 1 882 phikesl 4 496 3 305 phikesl duphaphthimikhwamlaexiydsungkwa 4 496 3 305 phikesl khnadifl 6 92 emkaibt chnidimm image jpeg rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid khwamyx khaxthibayBatangasCapitoljf0149 02 JPG English Upload Wizard photos of Batangas 1 Provincial Capitol 2 Complex Coordinates 13 45 55 N 121 3 50 E Batangas City the largest and capital city of the Province of Batangas the Industrial Port City of Calabarzon 2010 census the city has a population of 305 607 people wnthi 5 tulakhm ph s 2556 14 29 06aehlngthima ngankhxngtwphusrangsrrkh Ramon FVelasquez karxnuyatichsiththi ObjectThe depicted Philippine architecture 3D public art or other freedom of panorama FoP reliant work is in public domain because it is an architectural work completed prior to 15 thnwakhm ph s 2515 it is a sculpture monument or other artistic work created before 15 thnwakhm ph s 2515 and was not registered or an artistic work created before 1942 and which its copyright was not renewed and or it is an architecture completed on or after 15 thnwakhm ph s 2515 or an another type of artistic work not meeting the second criterion whose author or last surviving author e g the architect or sculptor has been deceased for 50 years or more therefore its copyright protection expired See Commons Copyright rules by territory Philippines Public domain exceptions for FoP reliant works for more information Images of copyrighted architecture and public art are normally not allowed on Wikimedia Commons unless there is an applicable freedom of panorama FoP in the works country of origin However there is no such exception in Republic Act No 8293 The Intellectual Property Code of the Philippines see Commons Copyright rules by territory Philippines Freedom of panorama for more information English Tagalog phaphthaykhapheca inthanaphuthuxlikhsiththikhxngphaphhruxsuxni xnuyatihichphaphhruxsuxniphayitenguxnikhtxipni iflnixyuphayitsyyaxnuyat khriexthifkhxmmxns aebbaesdngthima xnuyataebbediywkn 3 0 tnchbbkhunsamarth thicaaebngpn thicathasaena aeckcay aelasngngandngklawtxip thicaeriyberiyngihm thicaddaeplngngandngklaw phayitenguxnikhtxipni aesdngthima khuntxngihekiyrtiecakhxngnganxyangehmaasm odyephimlingkipyngsyyaxnuyat aelarabuhakmikarepliynaeplng khunxacthaechnniidinrupaebbidkidtamkhwr aettxngimichinlksnathiaenawaphuihxnuyatsnbsnunkhunhruxkarichngankhxngkhun xnuyataebbediywkn hakkhunddaeplng epliynrup hruxtxetimnganni khuntxngichsyyaxnuyataebbediywknhruxaebbthiehmuxnkbsyyaxnuyatthiichkbnganniethannhttps creativecommons org licenses by sa 3 0 CC BY SA 3 0 Creative Commons Attribution Share Alike 3 0 true truekhabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixairixethmthiaesdngxyuiniflniprakxbdwyphusrangbangkhathiimmiixethmwikisnethschuxphuichwikimiediy Ramon FVelasquezchuxphusrangsrrkh Ramon FVelasquezyuxaraexl https commons wikimedia org wiki user Ramon FVelasquezsthanalikhsiththimilikhsiththisyyaxnuyatCreative Commons Attribution ShareAlike 3 0 Unported xngkvswnthisrang wnkxtng5 tulakhm 2013bnthukphaphdwyNikon Coolpix AW100 xngkvsthimakhxngiflkarsrangdngedimodyphuxpohldmedia type xngkvsimage jpegchecksum xngkvs65e777fa400fd23d6ba2fbb97e22010e881af36fwithikarkahnd SHA 1 xngkvsdata size xngkvs7 258 125 ibtkhwamsung3 305 phikeslkhwamkwang4 496 phikesl prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann wnthi ewlarupyxkhnadphuichkhwamehnpccubn23 15 11 phvsphakhm 25604 496 3 305 6 92 emkaibt Clpo13straightened16 15 10 tulakhm 25564 608 3 456 5 84 emkaibt User created page with UploadWizard hnathimiphaphni hnatxipni oyngmathiphaphni cnghwdbatngks karichiflkhamokhrngkar wikixuntxipniichiflni karichbn ar wikipedia org باتانغاس karichbn bcl wikipedia org Batangas karichbn cbk zam wikipedia org Batangas karichbn ceb wikipedia org Gumagamit Lsjbot Duplicates Province of Batangas karichbn en wikipedia org Batangas Provincial Board karichbn en wikivoyage org Luzon karichbn he wikivoyage org הפיליפינים לוזון karichbn ka wikipedia org ბატანგასის პროვინცია karichbn ms wikipedia org Batangas karichbn no wikipedia org Batangas karichbn pag wikipedia org Batangas karichbn pam wikipedia org Batangas karichbn pt wikipedia org Batangas karichbn ru wikipedia org Batangas provinciya karichbn sco wikipedia org Batangas karichbn ta wikipedia org படன க ஸ karichbn tl wikipedia org Batangas karichbn uk wikipedia org Batangas provinciya karichbn ur wikipedia org باتانگاس karichbn vi wikipedia org Batangas karichbn www wikidata org Q13744khxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnnphuphlitklxngNIKONrunkhxngklxngCOOLPIX AW100ewlaepidhnaklxng1 400 winathi 0 0025 khaexff 7 8xtrakhwamerw ISO125ewlathibnthukphaph14 29 5 tulakhm 2556khwamyawofkselns5 mm height3 305width4 496khwamkwang4 608 phikeslkhwamsung3 456 phikeslbittxkhxmophennt8 8 8phikeslkhxmophsichnRGBkarcdwangphaphpkticanwnkhxmophennt3khwamlaexiydaenwnxn300 dpikhwamlaexiydaenwtng300 dpisxftaewrthiichAdobe Photoshop CC 2015 5 Windows aekikhphaphlasud09 14 11 phvsphakhm 2560taaehnng Y aela CCo sitedopraekrmexksophechxropraekrmpktirunexksif Exif 2 3ewlathiaeplngepndicithl14 29 5 tulakhm 2556khwamhmaykhxngaetlakhxmophenntY Cb Cr immikhaohmdkarbibxdphaph4khwamerwchtetxr8 643856kharurbaesng A 5 926948karchdechyaesng0rurbaesngkwangsud3 9 APEX f 3 86 ohmdkarwdaesngaephtethirnaesngimthrabaeflchimichaeflch ohmdxtonmtirunaeflchphiksthirxngrb1sepssisRGBtnchbbiflklxngthayphaphningdicithlchnidsinphaphthayodytrngkarpramwlphaphophlessspktiohmdexksophechxrexksophechxrxtonmtiiwtbalansiwtbalansxtonmtidicithlsum0rayaofksinfilm 35 mm 28 mm chnidsinaekhpecxrpktisinkhxnothrlekn sung lngkhwamepribbtangpktikhwamximsipktikhwamkhmpktirayahangwtthuphaphiklcudxangxingkhxngthisthangphaphthisthangaemehlkthisthangkhxngphaph114 53runciphiexsaethk0 0 3 2wnthiaekikhkhxmulemtalasud02 14 11 phvsphakhm 2560ID echphaakhxngexksartnchbbE27C6DB61A4A71A7BBEA951FB3F96340