ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkar khxmulekiywkbphaphimmiphaphthimiraylaexiydsungkwani Aurangzeb T0000253 104 jpg 318 500 phikesl khnadifl 37 kiolibt chnidimm image jpeg rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid Emperor Awrangzib Receives Prince Mu azzam CBL In 34 7 silpin phusrangsrrkhngan Attributed to Bhavanidas 1748 chuxxun Bhavani Daskhaxthibay citrkrwnekid wnesiychiwit before 2227 hrux 2228 date QS P 1685 00 00T00 00 00Z 7 P1326 1685 00 00T00 00 00Z 9 circa 2290 hrux 2291 rayaewlasrangsrrkhngan circa 2242 hrux 2243 2290 hrux 2291 sthanthisrangsrrkhngan edli 2242 hrux 2243 2261 hrux 2262 Kishangarh 2261 hrux 2262 2290 hrux 2291 ngankhwbkhumraykarhlkthan Q16628601 creator QS P170 Q16628601 P5102 Q230768 chuxeruxng Emperor Awrangzib Receives Prince Mu azzam CBL In 34 7 label QS Len Emperor Awrangzib Receives Prince Mu azzam CBL In 34 7 Object type culcitrkrrminexksartwekhiynsiwicitr folio citrkrrm khaxthibay Emperor Awrangzib Receives Prince Mu azzam Commentary This painting from an album complied for Shuja al Dawla a nawab of Oudh was produced at the end of the period of Mughal greatness Mughal power and wealth and hence artistic patronage and production peaked during the reigns of Akbar r 1556 1605 Jahangir r 1605 27 Shah Jahan r 1628 57 and Awrangzib r 1658 1707 Then in 1739 the Iranian ruler Nadir Shah sacked Delhi carrying back to Iran the riches of the Mughals their library treasury and even the fabled Peacock Throne More than anything this was a devastating psychological blow from which the Mughals never recovered Depicted people ckrphrrdixxrngesph Bahadur Shah Iwnthi 2249 hrux 2250 2254 hrux 2255 date QS P 1750 00 00T00 00 00Z 7 P1319 1707 00 00T00 00 00Z 9 P1326 1712 00 00T00 00 00Z 9 khnad khwamsung 302 0 mm khwamkwang 195 0 mm dimensions QS P2048 302U174789dimensions QS P2049 195U174789karekbrwbrwm Chester Beatty Library chuxinphasatnchbb Chester Beattythitng dblinphikd 53 20 31 2 ehnux 6 16 01 2 tawntk cdtngkhunemux ph s 2493 ewbist chesterbeatty iengankhwbkhumraykarhlkthan Q391976 VIAF 127596636 ISNI 0000000404881060 LCCN n80050107 SUDOC 027374297 BNF 122059908 WorldCat institution QS P195 Q391976rhskarthuxkhrxng In 34 7 Chester Beatty Library Place of creation ckrwrrdiomkul aehlngxangxing Google Arts amp Culture asset ID 0wHt2ABlb rnQA thima phuthayphaph 1 karxnuyat karichiflniihm Public domain Public domain false falseThis work is in the public domain in India because its term of copyright has expired The Indian Copyright Act applies in India to works first published in India According to the Indian Copyright Act 1957 as amended up to Act No 27 of 2012 Chapter V Section 25 Anonymous works photographs cinematographic works sound recordings government works and works of corporate authorship or of international organizations enter the public domain 60 years after the date on which they were first published counted from the beginning of the following calendar year i e as of 2024 works published prior to 1 January 1964 are considered public domain Posthumous works other than those above enter the public domain after 60 years from publication date counted from the beginning of the following calendar year Any kind of work other than the above enters the public domain 60 years after the author s death or in the case of a multi author work the death of the last surviving author counted from the beginning of the following calendar year Text of laws judicial opinions and other government reports are free from copyright The Indian Copyright Act 1957 is not retroactive so any work in which copyright did not subsist when it commenced did not have its copyright restored and is in the public domain per the Copyright Act 1911 nxkcaknikhunxactxngephimpaysatharnsmbtiinshrthxemrika ephuxrabuwaehtuidngannicungepnsatharnsmbtiinshrthxemrika oprdthrabwangannixacimepnsatharnsmbtiinpraethsthiimidichkdrayaewlakhumkhrxnglikhsiththithisnkwa aelamikhxkahnddanlikhsiththithiyawnankwaxayukhxngphusrangsrrkhbwkipxik 60 pi odyechphaapraethsemksiok 100 pi caemka 95 pi okhlxmebiy 80 pi kwetmalaaelasamw 75 pi switesxraelndaelashrthxemrika 70 pi العربي ة ব ল Deutsch English francais ह न द italiano 日本語 ಕನ ನಡ makedonski മലയ ള मर ठ Nederlands portugues do Brasil sicilianu தம ழ ತ ಳ اردو 繁體中文 khabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixairixethmthiaesdngxyuiniflniprakxbdwyEmperor Awrangzib Receives Prince Mu azzam CBL In 34 7 xngkvsdigital representation of xngkvsEmperor Awrangzib Receives Prince Mu azzam CBL In 34 7 xngkvshwkhxhlkEmperor Awrangzib Receives Prince Mu azzam CBL In 34 7 xngkvsmedia type xngkvsimage jpegchecksum xngkvsc9a7895066463c8911f02a700fa4b30f90153f35withikarkahnd SHA 1 xngkvsdata size xngkvs38 091 ibtkhwamsung500 phikeslkhwamkwang318 phikesl prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann wnthi ewlarupyxkhnadphuichkhwamehnpccubn06 08 10 minakhm 2551318 500 37 kiolibt Information Description Emperor Awrangzib Receives Prince Mu azzam Commentary This painting from an album complied for Shuja al Dawla a nawab of Oudh was produced at the end of the period of Mughal greatness Mughal power and wealth and hence arti hnathimiphaphni hnatxipni oyngmathiphaphni ckrphrrdixxrngesph karichiflkhamokhrngkar wikixuntxipniichiflni karichbn ast wikipedia org Aurangzeb karichbn bn wikipedia org আওরঙ গজ ব karichbn es wikipedia org Aurangzeb karichbn id wikibooks org India Kuno Sejarah Mughal karichbn ja wikipedia org 17世紀 アウラングゼーブ karichbn kn wikipedia org ಔರ ಗಜ ಬ karichbn ml wikipedia org മയ രസ ഹ സന karichbn nl wikipedia org Geschiedenis van Zuid Azie karichbn or wikipedia org ଆଉରଙ ଗଜ ବ karichbn pnb wikipedia org اورنگزیب پاکستان karichbn sco wikipedia org Aurangzeb karichbn ta wikipedia org வ க க ப ப ட ய உங கள க க த த ர ய ம 2011 மய ல சனம வ க க ப ப ட ய உங கள க க த த ர ய ம ட சம பர 21 2011 சல ம அல ஏர karichbn ur wikipedia org پاکستانkhxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnn error0