ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkar khxmulekiywkbphaphkhnadkhxngtwxyangni 800 411 phikesl khwamlaexiydxun 320 164 phikesl 640 329 phikesl 1 024 526 phikesl 1 280 658 phikesl 2 560 1 316 phikesl 5 760 2 960 phikesl duphaphthimikhwamlaexiydsungkwa 5 760 2 960 phikesl khnadifl 4 17 emkaibt chnidimm image jpeg rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid Quality phaphphaphniepnphaphkhunphaphtamhlkeknthkarphicarnaphaphkhunphaph nikhuxphaphkhdsrrinwikiphiediyphasaxahrb صور مختارة aela khux thuxwaepn phaphxyangidxyanghnungthidithisud nikhuxphaphkhdsrrinwikiphiediyphasaxngkvs Featured pictures aela khux thuxwaepn phaphxyangidxyanghnungthidithisud thakhidwaiflnikhwrcaihkhwamsakhykbwikimiediykhxmmxnsepnxyangdi xyalngelthica esnxchux hakkhunmiphaphthimikhunphaph khlaykhlungkn thicasamarthephyaephridtam syyaxnuyatthiehmaasm ihaenicwa khunid xpohld kahndsyyaxnuyat aelaid esnxchuxaelw Photo by Evan AmosAbout English This photo was taken by Evan Amos as a part of Vanamo Media which creates public domain works for educational purposes Please visit my other galleries and projects for other free media Personal Pages Vanamo Online Game Museum About Me Credits Wikipedia Talk Page Commons Talk Page InterviewsImage Galleries Candy Food People Everyday Video Games My FlickrkhaxthibaySega Genesis Mk2 6button jpg العربية نسخة أمريكي ة شمالي ة من جهاز سيگا جينيسيس مع حاكومه س داسي الأزرار بلغت سعة هذا الجهاز 16 بت ا وهو أحد أنظمة ألعاب الڤيديو من الجيل الرابع وقد صدر في سنة 1988 الجهاز الظاهر ه نا هو النسخة الثانية عن الأصل وقد أ صدر في وقت لاحق من حياة الأخير ب حاكوم س داسي الأزرار English A North American Sega Genesis video game console with 6 button controller The Sega Genesis is a 16 bit fourth generation game console that was first released in 1988 This is the second remodel of the console and is shown with a 6 button that was released later in the console s life wnthi 27 singhakhm ph s 2556aehlngthima ngankhxngtwphusrangsrrkh Evan Amoskarxnuyat karichiflniihm khapheca inthanaphuthuxlikhsiththikhxngphaphhruxsuxni xnuyatihichphaphhruxsuxniphayitenguxnikhtxipni iflnixyuphayitsyyaxnuyat khriexthifkhxmmxns aebbaesdngthima xnuyataebbediywkn 3 0 tnchbbkhunsamarth thicaaebngpn thicathasaena aeckcay aelasngngandngklawtxip thicaeriyberiyngihm thicaddaeplngngandngklaw phayitenguxnikhtxipni aesdngthima khuntxngihekiyrtiecakhxngnganxyangehmaasm odyephimlingkipyngsyyaxnuyat aelarabuhakmikarepliynaeplng khunxacthaechnniidinrupaebbidkidtamkhwr aettxngimichinlksnathiaenawaphuihxnuyatsnbsnunkhunhruxkarichngankhxngkhun xnuyataebbediywkn hakkhunddaeplng epliynrup hruxtxetimnganni khuntxngichsyyaxnuyataebbediywknhruxaebbthiehmuxnkbsyyaxnuyatthiichkbnganniethannhttps creativecommons org licenses by sa 3 0 CC BY SA 3 0 Creative Commons Attribution Share Alike 3 0 true true xnuyatihkhdlxk aeckcayaela hruxddaeprexksarniphayitenguxnikhkhxngsyyaxnuyatexksaresrikhxngknu run 1 2 hruxrunid nbcaknithixxkodymulnithisxftaewresri odyimmiswnidhamaekikh immikhxkhwampkhnaaelapkhlng saenakhxngsyyaxnuyatrwmxyuinswnchux syyaxnuyatexksaresrikhxngknuhttp www gnu org copyleft fdl html GFDL GNU Free Documentation License true truekhunsamartheluxksyyaxnuyatdngklawtamtxngkarewxrchnxun This file has been superseded by Sega Genesis Mk2 6button png It is recommended to use the other file Please note that deleting superseded images requires consent File Sega Genesis Mod2 Set jpg Version with 3 button controller khabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixairixethmthiaesdngxyuiniflniprakxbdwyphusrangbangkhathiimmiixethmwikisnethschuxphusrangsrrkh Evan Amoschuxphuichwikimiediy Evan Amosyuxaraexl https commons wikimedia org wiki user Evan AmossthanalikhsiththimilikhsiththisyyaxnuyatGNU Free Documentation License version 1 2 or later xngkvsCreative Commons Attribution ShareAlike 3 0 Unported xngkvsthimakhxngiflkarsrangdngedimodyphuxpohldwnthisrang wnkxtng27 singhakhm 2013bnthukphaphdwyNikon D7100 xngkvsCommons quality assessment xngkvsWikimedia Commons quality image xngkvsexposure time xngkvs0 004 winathif number xngkvs14focal length xngkvs70 milliemtrISO speed xngkvs100media type xngkvsimage jpegepnphaphthay prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann wnthi ewlarupyxkhnadphuichkhwamehnpccubn11 33 28 singhakhm 25565 760 2 960 4 17 emkaibt putting background to full white11 28 28 singhakhm 25565 760 2 960 4 64 emkaibt A North American Sega Genesis video game console with 6 button controller The Sega Genesis is a 16 bit fourth generation game console that was first released in 1988 This is the second remodel of the console and is shown with a 6 button that was r hnathimiphaphni hnatxipni oyngmathiphaphni eska emkaidrf karichiflkhamokhrngkar wikixuntxipniichiflni karichbn ar wikipedia org قائمة أكثر ألعاب الفيديو مبيعا ويكيبيديا صور مختارة أخرى أدوات إلكترونية ويكيبيديا ترشيحات الصور المختارة جهاز سيغا جينيسيس ويكيبيديا صورة اليوم المختارة يونيو 2019 قالب صورة اليوم المختارة 2019 06 21 الجيل الرابع من أنظمة ألعاب الفيديو قائمة ألعاب نينتندو سويتش أونلاين قائمة أكثر ألعاب ميجا درايف مبيعا ويكيبيديا صورة اليوم المختارة أبريل 2022 قالب صورة اليوم المختارة 2022 04 13 karichbn bs wikipedia org Sega karichbn de wikipedia org Liste der Mega Drive Spiele karichbn el wikipedia org Sega Mega Drive karichbn en wikipedia org List of Sega Genesis games Fourth generation of video game consoles Wikipedia Lamest edit wars Sega Channel Sega Genesis Sonic the Hedgehog 2 Wikipedia Lamest edit wars Names Wikipedia Featured pictures Engineering and technology Electronics 1980s in video games User talk Evan Amos User talk Evan Amos Wiki Notice Wikipedia WikiProject Video games Recognized content Wikipedia Featured pictures thumbs 40 Wikipedia Today s featured list August 2014 Wikipedia Featured picture candidates March 2014 Wikipedia Featured picture candidates Sega Genesis User talk Crisco 1492 Archive 48 Wikipedia Wikipedia Signpost 2014 04 23 Featured content Wikipedia Wikipedia Signpost Single 2014 04 23 Wikipedia Today s featured list August 15 2014 Wikipedia Main Page history 2014 August 15 List of best selling Sega Genesis games Portal Video games Recognized content List of Nintendo Switch Online games karichbn en wikibooks org Genesis Programming Category Book Genesis Programming History of video games Platforms Sega Genesis History of video games Print version Fourth Generation of Video Game Consoles karichbn es wikipedia org Videoconsola Sonic the Hedgehog 2 Mega Drive Usuario Xiuhcoatl Xiuhuitl borrador3 Videoconsolas de cuarta generacion Anexo Videojuegos mas vendidos de la Sega Mega Drive Sega Channel karichbn fa wikipedia org سگا چنل karichbn fi wikipedia org Sega Mega Drive karichbn ja wikipedia org セガチャンネル dukarichkhamokhrngkarephimetimkhxngiflnikhxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnnphuphlitklxngNIKON CORPORATIONrunkhxngklxngNIKON D7100ewlaepidhnaklxng1 250 winathi 0 004 khaexff 14xtrakhwamerw ISO100ewlathibnthukphaph17 58 27 singhakhm 2556khwamyawofkselns70 mm karcdwangphaphpktikhwamlaexiydaenwnxn240 dpikhwamlaexiydaenwtng240 dpisxftaewrthiichAdobe Photoshop CS5 Windowsaekikhphaphlasud00 31 28 singhakhm 2556opraekrmexksophechxrtngkhaexngrunexksif Exif 2 3ewlathiaeplngepndicithl17 58 27 singhakhm 2556khwamerwchtetxr7 965784kharurbaesng A 7 61471karchdechyaesng0rurbaesngkwangsud4 3 APEX f 4 44 ohmdkarwdaesngaephtethirnaesngimthrabaeflchimichaeflch rangbichaeflchesiywwinathi wnthi ewlatnchbb10esiywwinathi wnthi ewlathidiciiths10sepssiimidprbethiybkhwamlaexiydranabofks X255 86413574219khwamlaexiydranabofks Y255 86413574219hnwykhwamlaexiydranabofks4withikarwdesnesxrcudediywtnchbbiflklxngthayphaphningdicithlchnidsinphaphthayodytrngkarpramwlphaphophlessspktiohmdexksophechxrexksophechxrtngkhaexngiwtbalansiwtbalansxtonmtidicithlsum1rayaofksinfilm 35 mm 70 mm chnidsinaekhpecxrpktisinkhxnothrlimmikhwamepribbtangpktikhwamximsipktikhwamkhmpktirayahangwtthuimthrabhmayelkhsieriylkhxngklxng2557295elnsthiich55 0 300 0 mm f 4 5 5 6wnthiaekikhkhxmulemtalasud20 31 27 singhakhm 2556karihkhaaenn cak 5 0ID echphaakhxngexksartnchbbC6EC779BBC92972C7D12467BA7569878run IIM41 720