ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkar khxmulekiywkbphaphkhnadkhxngtwxyangni 800 488 phikesl khwamlaexiydxun 320 195 phikesl 640 391 phikesl 1 024 625 phikesl 1 280 781 phikesl 2 560 1 562 phikesl 5 310 3 240 phikesl duphaphthimikhwamlaexiydsungkwa 5 310 3 240 phikesl khnadifl 5 4 emkaibt chnidimm image jpeg rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid khaxthibayPlayStation Vita 1101 FL jpg The PlayStation Vita a handheld gaming console by Sony released in 2012 The successor to the PlayStation Portable PSP the Vita has numerous improvements over the previous system It has rear and front touchscreens dual analog sticks and a higher resolution OLED screen This model the PCH 1101 also has built in 3G wireless service support but also comes in a Wi Fi PCH 1001 model wnthi 31 minakhm ph s 2558aehlngthima ngankhxngtwphusrangsrrkh Evan Amoskarxnuyat karichiflniihm Public domain Public domain false falsekhapheca phuthuxlikhsiththiinnganni khxmxbnganihepnsatharnsmbti prakasnimiphlthwolk inbangpraeths karkrathadngklawxacimsamarththaidtamkdhmay khaphecaxnuyatihthukkhnmisiththiinkarichiflniinthukehtuphlkarich odyimmimienguxnikh ewnaetkdhmayimxnuyatihthaechnnnewxrchnxun PNG version Photo by Evan AmosAbout English This photo was taken by Evan Amos as a part of Vanamo Media which creates public domain works for educational purposes Please visit my other galleries and projects for other free media Personal Pages Vanamo Online Game Museum About Me Credits Wikipedia Talk Page Commons Talk Page InterviewsImage Galleries Candy Food People Everyday Video Games My Flickr nikhuxphaphkhdsrrinwikiphiediyphasaxngkvs Featured pictures aela khux thuxwaepn phaphxyangidxyanghnungthidithisud thakhidwaiflnikhwrcaihkhwamsakhykbwikimiediykhxmmxnsepnxyangdi xyalngelthica esnxchux hakkhunmiphaphthimikhunphaph khlaykhlungkn thicasamarthephyaephridtam syyaxnuyatthiehmaasm ihaenicwa khunid xpohld kahndsyyaxnuyat aelaid esnxchuxaelwkhabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixairxngkvsPlayStation Vitaixethmthiaesdngxyuiniflniprakxbdwyphusrangbangkhathiimmiixethmwikisnethschuxphuichwikimiediy Evan Amosyuxaraexl https commons wikimedia org wiki user Evan Amoschuxphusrangsrrkh Evan Amossthanalikhsiththicopyrighted dedicated to the public domain by copyright holder xngkvssyyaxnuyatreleased into the public domain by the copyright holder xngkvswnthisrang wnkxtng31 minakhm 2015thimakhxngiflkarsrangdngedimodyphuxpohldbnthukphaphdwyNikon D7100 xngkvsmedia type xngkvsimage jpeg prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann wnthi ewlarupyxkhnadphuichkhwamehnpccubn02 48 1 emsayn 25585 310 3 240 5 4 emkaibt desaturating screen and lightening a bit02 41 1 emsayn 25585 310 3 240 5 37 emkaibt Information Description The PlayStation Vita a handheld gaming console by Sony released in 2012 The successor to the PlayStation Portable PSP the Vita has numerous improvements over the previous system It has rear and front touchscreens dua hnathimiphaphni hnatxipni oyngmathiphaphni ephlysetchn wita karichiflkhamokhrngkar wikixuntxipniichiflni karichbn an wikipedia org PlayStation Vita karichbn ar wikipedia org قائمة أكثر ألعاب الفيديو مبيعا مستخدم أبو الشاي حليب ملعب 2 karichbn arz wikipedia org نيجتكرى karichbn ast wikipedia org PlayStation Vita karichbn be wikipedia org PlayStation Vita karichbn ca wikipedia org PlayStation Vita karichbn ckb wikipedia org پلەیستەیشن ڤیتا karichbn cs wikipedia org PlayStation Vita karichbn da wikipedia org PlayStation Vita karichbn de wikipedia org PlayStation Vita Benutzer Torben Friedrich Liste der Exponate im Museum Hi Score karichbn en wikipedia org Handheld game console List of commercial failures in video games PlayStation Wikipedia Featured pictures Engineering and technology Electronics 2010s in video games PlayStation Vita User talk Evan Amos Uncharted Golden Abyss Wipeout 2048 Eighth generation of video game consoles Talk PlayStation Vita Archive 1 PlayStation 4 Wikipedia WikiProject Video games Recognized content User Armbrust FPs List of handheld game consoles Wikipedia Featured pictures thumbs 60 User talk Armbrust Archive 21 Wikipedia Wikipedia Signpost 2017 06 09 Featured content Wikipedia Featured picture candidates File PlayStation Vita 1101 FL jpg Wikipedia Featured picture candidates June 2017 Wikipedia Wikipedia Signpost Single 2017 06 09 Wikipedia Wikipedia Signpost 2017 06 23 Featured content Wikipedia Wikipedia Signpost Single 2017 06 23 Wikipedia Picture of the day August 2018 Template POTD 2018 08 21 Wikipedia Main Page history 2018 August 21 Portal Video games Recognized content Portal 2010s karichbn en wikibooks org History of video games Platforms PlayStation Vita Emulation PlayStation Vita karichbn es wikipedia org Videoconsola portatil Videoconsolas de octava generacion Wipeout 2048 Usuario Freddie1970 Taller karichbn et wikipedia org PlayStation karichbn eu wikipedia org PlayStation Vita karichbn fa wikipedia org پلی استیشن ویتا karichbn hu wikipedia org Kezi videojatek konzolok listaja dukarichkhamokhrngkarephimetimkhxngiflnikhxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnnphuphlitklxngNIKON CORPORATIONrunkhxngklxngNIKON D7100phuthayEvan AmosphuthrnglikhsiththiVanamo Media Public Domainewlaepidhnaklxng1 250 winathi 0 004 khaexff 18xtrakhwamerw ISO100ewlathibnthukphaph11 16 31 minakhm 2558khwamyawofkselns145 mm karcdwangphaphpktikhwamlaexiydaenwnxn240 dpikhwamlaexiydaenwtng240 dpisxftaewrthiichAdobe Photoshop CS5 Windowsaekikhphaphlasud15 48 31 minakhm 2558opraekrmexksophechxrtngkhaexngrunexksif Exif 2 3ewlathiaeplngepndicithl11 16 31 minakhm 2558khwamerwchtetxr7 965784kharurbaesng A 8 33985karchdechyaesng0rurbaesngkwangsud3 APEX f 2 83 ohmdkarwdaesngaephtethirnaesngimthrabaeflchimichaeflch rangbichaeflchesiywwinathi wnthi ewlatnchbb70esiywwinathi wnthi ewlathidiciiths70sepssiimidprbethiybkhwamlaexiydranabofks X2 558 641204834khwamlaexiydranabofks Y2 558 641204834hnwykhwamlaexiydranabofks3withikarwdesnesxrcudediywtnchbbiflklxngthayphaphningdicithlchnidsinphaphthayodytrngkarpramwlphaphophlessspktiohmdexksophechxrexksophechxrtngkhaexngiwtbalansiwtbalanstngkhaexngdicithlsum1rayaofksinfilm 35 mm 217 mm chnidsinaekhpecxrpktisinkhxnothrlimmikhwamepribbtangpktikhwamximsipktikhwamkhmpktirayahangwtthuimthrabhmayelkhsieriylkhxngklxng2557295elnsthiich80 0 200 0 mm f 2 8wnthiaekikhkhxmulemtalasud11 48 31 minakhm 2558ID echphaakhxngexksartnchbb7DFB91AEA85C6C75FEC31D1859A32192run IIM4