ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkar khxmulekiywkbphaphkhnadkhxngtwxyang PNG nikhxngifl SVG ni 800 400 phikesl khwamlaexiydxun 320 160 phikesl 640 320 phikesl 1 024 512 phikesl 1 280 640 phikesl 2 560 1 280 phikesl duphaphthimikhwamlaexiydsungkwa ifl SVG 1 200 600 phikesl khnadifl 9 kiolibt rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid khwamyx khaxthibayFlag of New South Wales svg English Flag and government ensign internal waters only of New South Wales wnthi 27 mkrakhm ph s 2549aehlngthima xrmap flag collection 2 9 Modifications by Denelson83 and User Greentubing original Official colour specifications from government booklet Blue Pantone 2758 Red Pantone 485 Yellow Pantone 123phusrangsrrkh Denelson83 original karxnuyatichsiththi iflnixyuphayitsyyaxnuyat khriexthifkhxmmxns aebbaesdngthima xnuyataebbediywkn 4 0 nanachatikhunsamarth thicaaebngpn thicathasaena aeckcay aelasngngandngklawtxip thicaeriyberiyngihm thicaddaeplngngandngklaw phayitenguxnikhtxipni aesdngthima khuntxngihekiyrtiecakhxngnganxyangehmaasm odyephimlingkipyngsyyaxnuyat aelarabuhakmikarepliynaeplng khunxacthaechnniidinrupaebbidkidtamkhwr aettxngimichinlksnathiaenawaphuihxnuyatsnbsnunkhunhruxkarichngankhxngkhun xnuyataebbediywkn hakkhunddaeplng epliynrup hruxtxetimnganni khuntxngichsyyaxnuyataebbediywknhruxaebbthiehmuxnkbsyyaxnuyatthiichkbnganniethannhttps creativecommons org licenses by sa 4 0 CC BY SA 4 0 Creative Commons Attribution Share Alike 4 0 true true Public domain Public domain false falseThis image or other work is of Australian origin and is now in the public domain because its term of copyright has expired According to the Australian Copyright Council ACC ACC Information Sheet G023v19 Duration of copyright January 2019 1 Type of materialCopyright has expired if A Photographs or other works published anonymously under a pseudonym or the creator is unknown taken or published prior to 1 mkrakhm ph s 2498BPhotographs except A taken prior to 1 mkrakhm ph s 2498CArtistic works except A amp B the creator died before 1 mkrakhm ph s 2498DPublished editions2 except A amp B first published more than 25 years agoECommonwealth State or Territory owned3 photographs and engravings taken or published more than 50 years ago1Copyright Amendment Disability Access and Other Measures Bill 2017 Australian Government 2means the typographical arrangement and layout of a published work eg newsprint 3owned means where a government is the copyright owner as well as would have owned copyright but reached some other agreement with the creator When using this template please provide information of where the image was first published and who created it nxkcaknikhunxactxngephimpaysatharnsmbtiinshrthxemrika ephuxrabuwaehtuidngannicungepnsatharnsmbtiinshrthxemrika العربية catala Deutsch English espanol francais 日本語 makedonski മലയ ള Nederlands russkij slovenscina Tok Pisin Turkce ukrayinska 简体中文 繁體中文 AustraliaPublic domain Public domain false falseThis work created by the United Kingdom Government is in the public domain This is because it is one of the following It is a photograph taken prior to 1 June 1957 or It was published prior to 1974 or It is an artistic work other than a photograph or engraving e g a painting which was created prior to 1974 HMSO has declared that the expiry of Crown Copyrights applies worldwide ref HMSO Email Reply More information See also Copyright and Deutsch English Espanol francais italiano Nederlands polski portugues sicilianu slovenscina suomi Turkce makedonski russkij ukrayinska മലയ ള 한국어 日本語 简体中文 繁體中文 العربية xnuyatihkhdlxk aeckcayaela hruxddaeprexksarniphayitenguxnikhkhxngsyyaxnuyatexksaresrikhxngknu run 1 2 hruxrunid nbcaknithixxkodymulnithisxftaewresri odyimmiswnidhamaekikh immikhxkhwampkhnaaelapkhlng saenakhxngsyyaxnuyatrwmxyuinswnchux syyaxnuyatexksaresrikhxngknuhttp www gnu org copyleft fdl html GFDL GNU Free Documentation License true truephaphniepnphaphthng traxarm traaephndin traprathb traphaphphimph tlxdcnekhruxnghmaykhxngthangkarxun sungkarichnganekhruxnghmaydngklawthukcakdaelakhwbkhumodykdhmayxun thiaeykipcakkdhmaylikhsiththiinhlaypraethskhabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixairebrtnBanniel ha pavilhon stad douriou diabarzh hepken Sukembre NevezixethmthiaesdngxyuiniflniprakxbdwysthanalikhsiththimilikhsiththisyyaxnuyatCreative Commons Attribution ShareAlike 4 0 International xngkvsGNU Free Documentation License version 1 2 or later xngkvswnthisrang wnkxtng27 mkrakhm 2006media type xngkvsimage svg xml prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann lasud du ihmkwa 10 10 wnthi ewlarupyxkhnadphuichkhwamehnpccubn02 19 12 knyayn 25651 200 600 9 kiolibt Fry1989Reverted to version as of 18 20 19 July 2022 UTC 08 38 9 knyayn 25651 280 640 35 kiolibt Reverted to version as of 12 40 11 November 2017 UTC These shades do not appear on the common variety of the flag01 20 20 krkdakhm 25651 200 600 9 kiolibt HapHaxionreduce file size22 14 3 mithunayn 25651 200 600 14 kiolibt HapHaxionReverted to version as of 01 03 2 December 2018 UTC 17 17 9 emsayn 25651 200 600 16 kiolibt Fixed08 03 2 thnwakhm 25611 200 600 14 kiolibt Fry1989Adjust stars07 49 2 thnwakhm 25611 200 600 14 kiolibt Fry1989Redo badge06 30 21 mithunayn 25611 280 640 35 kiolibt Zscout370Reverted to version as of 05 02 21 February 2018 UTC the NSW Government specified otherwise https static nsw gov au siteassets Uploads flag and emblems book 15sept2015 interactive pdf21 34 19 mithunayn 25611 280 640 35 kiolibt Reverted to version as of 12 40 11 November 2017 UTC The state flags of Australia should all have the same shades of blue and red12 02 21 kumphaphnth 25611 280 640 35 kiolibt use Pantone website conversion of government Pantone specs lasud du ihmkwa 10 10 hnathimiphaphni hnatxipni oyngmathiphaphni karlngprachamtiwadwysatharnrthxxsetreliy ph s 2542 khnaaephthysastr mhawithyalyekstrsastr khrawnokholni sidniy thngchatixxsetreliy thngaesdngsychatisinaengin misaekrndkhiwba misaekrndxxsetreliy rthniwesathewls rthaeladinaednkhxngpraethsxxsetreliy raychuxthnginpraethsxxsetreliy raychuxswnstw raychuxekhtkarpkkhrxng raychuxekhtkarpkkhrxngtamkhnadphunthi raychuxaekhkinphrarachphithirachaphieskkhxngsmedcphraecachalsthi 3 aelasmedcphrarachinikhamilla xananikhmniwesathewls phuich Armin Arlertz krabathray18 phuich Rattakorn c sandbox6 aemaebb Country data New South Wales aemaebb thngxxsetreliy karichiflkhamokhrngkar wikixuntxipniichiflni karichbn af wikipedia org Tweede Vryheidsoorlog Broken Hill Wallabies Sydney Deelstate en gebiede van Australie Nieu Suid Wallis Sutherland Shire Kurnell Cronulla Woolooware Lilli Pilli Taren Point Sutherland Nieu Suid Wallis Wollongong Bledisloebeker Bondi Beach Hartley Oyster Bay Newcastle Nieu Suid Wallis Suiderkruisvlae Vlae van deelstate en gebiede van Australie Vlag van die Verenigde Koninkryk Aborigines Barraba Sjabloon Landdata Nieu Suid Wallis Geografiese verspreiding van Afrikaanssprekendes Suid Afrikaanse Australiers Oporto restaurant Lord Howe eiland karichbn als wikipedia org Sydney Vorlage Info ISO 3166 2 AU NSW karichbn ang wikipedia org Niwe Suthwealas karichbn an wikipedia org Usuario Willtron Puestos Organizacion territorial d Australia Nueva Galas d o Sud Usuario Willtron Puestos Paises Rio Kedumba Rio Parramatta karichbn ar wikipedia org نيوساوث ويلز علم أستراليا جامعة ولونغونغ علم توفالو علم المملكة المتحدة علم مقاطعة كولومبيا البريطانية علم أونتاريو علم بليز علم برمودا علم جزر كايمان علم جزر توركس وكايكوس علم مونتسيرات dukarichkhamokhrngkarephimetimkhxngiflnikhxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnnkhwamkwang1200khwamsung600