ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkar khxmulekiywkbphaphimmiphaphthimiraylaexiydsungkwani CommonwealthPrimeMinisters1944 jpg 640 470 phikesl khnadifl 85 kiolibt chnidimm image jpeg rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid khaxthibayCommonwealthPrimeMinisters1944 jpg English Commonwealth Prime Ministers Conference London UK L R Rt Hon W L Mackenzie King Canada General the Rt Hon Jan Smuts South Africa Rt Hon Winston Churchill United Kingdom Rt Hon Peter Fraser New Zealand Rt Hon John Curtin Australia wnthi 1 phvsphakhm ph s 2487aehlngthima This image is available from Library and Archives Canada under the reproduction reference number C 068672 and under the MIKAN ID number 3362906 This tag does not indicate the copyright status of the attached work A normal copyright tag is still required See Commons Licensing Library and Archives Canada does not allow free use of its copyrighted works See Category Images from Library and Archives Canada English francais makedonski 日本語 phusrangsrrkh not statedkarxnuyat karichiflniihm Public domain Public domain false falseThis Canadian work is in the public domain in Canada because its copyright has expired due to one of the following 1 it was subject to Crown copyright and was first published more than 50 years ago or it was not subject to Crown copyright and 2 it is a photograph that was created prior to January 1 1949 or 3 the creator died prior to January 1 1972 nxkcaknikhunxactxngephimpaysatharnsmbtiinshrthxemrika ephuxrabuwaehtuidngannicungepnsatharnsmbtiinshrthxemrika oprdthrabwangannixacimepnsatharnsmbtiinpraethsthiimidichkdrayaewlakhumkhrxnglikhsiththithisnkwa aelamikhxkahnddanlikhsiththithiyawnankwaxayukhxngphusrangsrrkhbwkipxik 60 pi odyechphaaxyangyingpraethsemksiok 100 pi caemka 95 pi okhlxmebiy 80 pi kwetmalaaelasamw 75 pi switesxraelndaelashrthxemrika 70 pi aelaewensuexla 60 pi العربية ব ল cestina Deutsch English espanol suomi francais italiano 日本語 한국어 makedonski മലയ ള Nederlands portugues portugues do Brasil sicilianu slovenscina 简体中文 繁體中文 AnnotationsInfoFieldThis image is annotated View the annotations at Commons96 138 59 103 640 470 The Right Honourable William Lyon Mackenzie King Prime Minister of Canada 186 32 62 107 640 470 The Right Honourable Field Marshal Jan Smuts Prime Minister of South Africa 302 138 57 91 640 470 The Right Honourable Sir Winston Churchill Prime Minister of the United Kingdom 381 19 65 119 640 470 The Right Honourable Peter Fraser Prime Minister of New Zealand 459 130 66 113 640 470 The Right Honourable John Curtin Prime Minister of AustraliakhabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixairixethmthiaesdngxyuiniflniprakxbdwyWilliam Blomfield xngkvswileliym ilxn aemkekhnsi khingwnthisrang wnkxtng1 phvsphakhm 1944media type xngkvsimage jpegchecksum xngkvse777760abaa0cc9077b367c39748e03a147509fbwithikarkahnd SHA 1 xngkvsdata size xngkvs86 717 ibtkhwamsung470 phikeslkhwamkwang640 phikesl prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann wnthi ewlarupyxkhnadphuichkhwamehnpccubn09 24 7 mkrakhm 2551640 470 85 kiolibt Information Description Commonwealth Prime Ministers Conference L R Rt Hon W L Mackenzie King General Jan Smuts Rt Hon Winston Churchill Rt Hons Peter Fraser John Curtin Source LAC C 068672 3362906 Date 1 May 1944 Author Librar hnathimiphaphni immihnaidoyngmathiphaphnikarichiflkhamokhrngkar wikixuntxipniichiflni karichbn af wikipedia org Britse Statebond Geallieerdes van die Tweede Wereldoorlog karichbn ar wikipedia org رئيس الوزراء كبير الوزراء رئيس حكومة بوابة الكومنولث بوابة الكومنولث صورة مختارة أرشيف بوابة الكومنولث صورة مختارة 1 karichbn arz wikipedia org رئيس الوزرا karichbn ast wikipedia org Xefe de Gobiernu karichbn bg wikipedia org Obshnost na naciite karichbn bn wikipedia org ম খ যমন ত র সরক রপ রধ ন karichbn ca wikipedia org Primer ministre Commonwealth Domini britanic karichbn ckb wikipedia org سەرۆک وەزیران karichbn cs wikipedia org Predseda vlady Hlava vlady karichbn cy wikipedia org Prif weinidog karichbn de wikipedia org Commonwealth of Nations Dominion Peter Fraser karichbn el wikipedia org Gian Smats Diaskepsh twn Prw8ypoyrgwn ths Koinopoliteias toy 1944 karichbn en wikipedia org Commonwealth Heads of Government Meeting Prime minister William Lyon Mackenzie King 1944 Head of government Jan Smuts Commonwealth realm Peter Fraser History of Western civilization Commonwealth Prime Ministers Conference Commonwealth of Nations Dominion Curtin government 1944 Commonwealth Prime Ministers Conference Diplomatic history of World War II karichbn eo wikipedia org Komunumo de Nacioj karichbn es wikipedia org Mancomunidad de Naciones Primer ministro Jefe de Gobierno Dominio britanico Historia diplomatica de la Segunda Guerra Mundial karichbn eu wikipedia org Commonwealth erakundea Agindupeko lur karichbn fa wikipedia org رئیس دولت جون کارتین dukarichkhamokhrngkarephimetimkhxngiflnikhxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnn error0