ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkar khxmulekiywkbphaphkhnadkhxngtwxyangni 783 600 phikesl khwamlaexiydxun 313 240 phikesl 627 480 phikesl 1 002 768 phikesl 1 280 981 phikesl 2 610 2 000 phikesl duphaphthimikhwamlaexiydsungkwa 2 610 2 000 phikesl khnadifl 3 55 emkaibt chnidimm image jpeg rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid khwamyx Object Harbaville Triptych silpin phusrangsrrkhngan Unknown artistUnknown artistchuxeruxng xngkvs Harbaville Triptych Apostles title QS P1476 en Harbaville Triptych Apostles label QS Len Harbaville Triptych Apostles label QS Lsl Harbavillski triptih label QS Lel Triptyxo Armpabil label QS Lfr Triptyque Harbaville label QS Lzh 哈巴维尔三联画 label QS Lzh hant 哈巴維爾三聯畫 label QS Lpl Tryptyk Harbaville label QS Les Triptico Harbaville label QS Lde Harbaville Triptychon label QS Lzh cn 哈巴维尔三联画 label QS Lru Triptih Arbavilya label QS Len gb Harbaville Triptych label QS Len ca Harbaville Triptych label QS Lzh hans 哈巴维尔三联画 Object type banphbphaph pratimakrrm carving khaxthibay Deutsch Abgebildet ist eine Deesis mit Christus zwischen ihm sich zuwendenden Maria und Johannes zu seinen Seiten Uber dem Thron sind zwei Engelsbusten in Tondi Die Mitteltafel wird durch drei Dekorbander aus Palmetten im Wechsel mit einem floralen Motiv gegliedert Das obere Schmuckband ist mit drei Medaillons mit kleinen Busten unterteilt In der Mitte ist der Prophet Elias links der Prophet Jeremias und rechts der Prophet Isaias abgebildet Unter der Deesis stehen funf Apostel In der Mitte Petrus zu seinen Seiten Paulus und Andreas links und Johannes der Evangelist und Jakobus rechts Francais Deisis et saints La partie centrale sculptee en tres fort relief offre deux registres superposes separes par un bandeau a decor de palmettes et de fleurons alternes Au registre superieur le Christ trone entre la Vierge et saint Jean Baptiste tous deux debout de chaque cote et tournes vers lui pour former la traditionnelle Deisis la priere d intercession pour l Humanite Au dessus du trone deux anges en buste s inscrivent dans des couronnes vegetales rehaussees d etoiles Ils sont anonymes a la difference de tous les autres personnages du triptyque identifies par les inscriptions gravees En dessous de la Deisis prennent place cinq apotres Pierre au centre Paul et Andre a sa gauche et a sa droite Jean Evangeliste et Jacques Deux bandeaux enferment la partie centrale Sur celui du haut trois petits medaillons contiennent chacun un buste il s agit de trois prophetes Elie place au dessus du Christ Jeremie a gauche et Isaie a droite Les volets se divisent en trois registres des saints en pied aux registres superieur et inferieur et des saints en buste inscrits dans des medaillons au registre median Deisis and saints Depicted people phraeysu wnthi 1482 hrux 1483 1502 hrux 1503 date QS P 950 00 00T00 00 00Z 7 P1319 0940 00 00T00 00 00Z 9 P1326 0960 00 00T00 00 00Z 9 suxthiephyaephr ivory polychromy bas relief and high relief khnad 24 2 28 2 1 2 cmkarekbrwbrwm phiphithphnthlufwr phaphkhxngphunthi chuxinphasatnchbb Louvre Museum thitng 1st arrondissement of Paris praethsfrngessphikd 48 51 40 ehnux 2 20 09 tawnxxk cdtngkhunemux 10 singhakhm ph s 2336 ewbist www louvre frngankhwbkhumraykarhlkthan Q19675 VIAF 257711507 ISNI 000000012260177X ULAN 500125189 OSM 7515426 Open Library OL3141048A WorldCat institution QS P195 Q19675taaehnngthixyu Department of Decorative Arts Richelieu ground floor room 1rhskarthuxkhrxng OA 3247Place of creation khxnsaetntionepil prawtikhxngwtthuni Former collections Beugny de Pommeras Harbaville purchase 1891aehlngxangxing Louvre Museum ARK ID 010112515 Art in the Christian Tradition ID 54525 Q109371722 p 16 ngankhwbkhumraykarhlkthan Q23356 Louvre 010112515 phaphthay aehlngthima Jastrow 2006 karxnuyatichsiththi Public domain Public domain false falsekhapheca phuthuxlikhsiththiinnganni khxmxbnganihepnsatharnsmbti prakasnimiphlthwolk inbangpraeths karkrathadngklawxacimsamarththaidtamkdhmay khaphecaxnuyatihthukkhnmisiththiinkarichiflniinthukehtuphlkarich odyimmimienguxnikh ewnaetkdhmayimxnuyatihthaechnnnkhabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixairixethmthiaesdngxyuiniflniprakxbdwyHarbaville Triptych xngkvssthanalikhsiththicopyrighted dedicated to the public domain by copyright holder xngkvssyyaxnuyatreleased into the public domain by the copyright holder xngkvsbnthukphaphdwyNikon D70 xngkvshwkhxhlkHarbaville Triptych xngkvsexposure time xngkvs0 05 winathif number xngkvs4 5focal length xngkvs18 milliemtrISO speed xngkvs1 000media type xngkvsimage jpegepnphaphthay prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann wnthi ewlarupyxkhnadphuichkhwamehnpccubn15 59 8 krkdakhm 25492 610 2 000 3 55 emkaibt Jastrowcorrected barrel distorsion enhanced lighting reduced noise19 52 15 mkrakhm 25492 670 2 000 3 46 emkaibt Jastrow Description Deesis and saints Harbaville Triptych middle of the 10th century ivory lt br gt Alternate views back side of the triptych Image Saints triptych Harbaville Louvre OA3247 hnathimiphaphni hnatxipni oyngmathiphaphni banphbphaph karichiflkhamokhrngkar wikixuntxipniichiflni karichbn ar wikipedia org نقش بارز ديسيس karichbn ast wikipedia org Escultura karichbn bg wikipedia org Makedonski renesans Izkustvo na Vizantiya karichbn bn wikipedia org ক র শ ল প karichbn bs wikipedia org Makedonska umjetnost bizantijska Bizantijski iluminirani rukopisi karichbn ca wikipedia org Triptic Deisi Consagracio de Roma i Eudoxia karichbn cs wikipedia org Byzantske vytvarne umeni karichbn de wikipedia org Elfenbein Triptychon Diskussion Triptychon Harbaville Triptychon Benutzer Artikelstube Liste von Bauteilen im Bauwesen karichbn el wikipedia org Triptyxo Armpabil karichbn en wikipedia org Sculpture Relief Deesis Macedonian art Byzantine Harbaville Triptych Romanos Ivory User Mdd Organizational chart karichbn es wikipedia org Renacimiento macedonio Consagracion de Romanos y Eudoxia Triptico Harbaville karichbn fa wikipedia org نقش برجسته karichbn fr wikipedia org Deisis Triptyque Harbaville karichbn he wikipedia org טריפטיכון karichbn hu wikipedia org Romanika karichbn hy wikipedia org Քանդակագործություն karichbn it wikipedia org Rilievo scultura karichbn ja wikipedia org 彫刻 karichbn lt wikipedia org Bizantijos menas karichbn nl wikipedia org Ivoorsnijwerk karichbn pl wikipedia org Luwr Wikipedysta Ludwig Schneider Artykuly Tryptyk Harbaville Plastyka z kosci sloniowej karichbn ru wikipedia org Slonovaya kost Triptih Triptih Arbavilya karichbn sk wikipedia org Byzantske vytvarne umenie Byzantske umenie v macedonskom obdobi karichbn sl wikipedia org Kiparstvo Deesis Harbavillski triptih dukarichkhamokhrngkarephimetimkhxngiflnikhxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnnphuphlitklxngNIKON CORPORATIONrunkhxngklxngNIKON D70ewlaepidhnaklxng1 20 winathi 0 05 khaexff 4 5xtrakhwamerw ISO1 000ewlathibnthukphaph13 26 11 mkrakhm 2549khwamyawofkselns18 mm karcdwangphaphpktikhwamlaexiydaenwnxn300 dpikhwamlaexiydaenwtng300 dpisxftaewrthiichDxO Optics Pro Standard MACOSX 3 55b 6377581 356110 BMVDCTFaekikhphaphlasud13 26 11 mkrakhm 2549taaehnng Y aela CCo sitedopraekrmexksophechxrkahndrurbaesngepnhlk a runexksif Exif 2 21ewlathiaeplngepndicithl13 26 11 mkrakhm 2549khwamhmaykhxngaetlakhxmophenntY Cb Cr immikhaohmdkarbibxdphaph4khwamerwchtetxr4 321928kharurbaesng A 4 33985karchdechyaesng0 33333333333333rurbaesngkwangsud3 6 APEX f 3 48 ohmdkarwdaesngaephtethirnaesngimthrabaeflchimichaeflchesiywwinathi wnthi ewla70esiywwinathi wnthi ewlatnchbb70esiywwinathi wnthi ewlathidiciiths70runaeflchphiksthirxngrb1sepssisRGBwithikarwdesnesxrcudediywtnchbbiflklxngthayphaphningdicithlchnidsinphaphthayodytrngkarpramwlphaphophlessspktiohmdexksophechxrexksophechxrxtonmtiiwtbalansiwtbalansxtonmtidicithlsum1rayaofksinfilm 35 mm 27 mm chnidsinaekhpecxrpktisinkhxnothrlekn ta khunkhwamepribbtangpktikhwamximsipktikhwamkhmhardrayahangwtthuimthrab