ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkar khxmulekiywkbphaphkhnadkhxngtwxyangni 433 599 phikesl khwamlaexiydxun 173 240 phikesl 347 480 phikesl 555 768 phikesl 740 1 024 phikesl 1 481 2 048 phikesl 3 415 4 723 phikesl duphaphthimikhwamlaexiydsungkwa 3 415 4 723 phikesl khnadifl 8 48 emkaibt chnidimm image jpeg rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid khwamyx khaxthibayNiels Bohr LOC ggbain 35303 jpg English Title Prof Bohr Abstract medium 1 negative glass 5 x 7 in or smaller wnthi Unknown circa 1910 based on comparison with this circa 1910 photo aehlngthima Library of Congress Catalog https lccn loc gov 2014715454 Image download https cdn loc gov master pnp ggbain 35300 35303u tif Original url https www loc gov pictures item 2014715454 phusrangsrrkh Bain News Service publisher Restored by Bammeskkarxnuyat karichiflniihm No known restrictions on publication For more information see George Grantham Bain Collection Rights and Restrictions Information https www loc gov rr print res 274 bain html This image is available from the United States Library of Congress s Prints and Photographs division under the digital ID ggbain 35303 This tag does not indicate the copyright status of the attached work A normal copyright tag is still required See Commons Licensing العربية belaruskaya tarashkevica ব ল cestina Deutsch English espanol فارسی suomi francais galego עברית magyar Bahasa Indonesia italiano 日本語 lietuviu makedonski മലയ ള Nederlands polski portugues portugues do Brasil romană russkij sicilianu slovencina slovenscina Turkce ukrayinska 简体中文 繁體中文 ewxrchnxun File Niels Bohr LOC ggbain 35303 png Restoration PNG File Prof Bohr LCCN2014715454 tif Original TIFF File Prof Bohr LCCN2014715454 jpg Original JPEG unrestored File Niels Bohr Date Unverified LOC jpg JPEG restored low resolutionCollectionInfoFieldGeorge Grantham Bain CollectionNotesInfoFieldPhoto shows physicist Niels Bohr Title from unverified data provided by the Bain News Service on the negatives or caption cards Forms part of George Grantham Bain Collection Library of Congress General information about the George Grantham Bain Collection is available at https hdl loc gov loc pnp pp ggbainPart ofInfoFieldbain collection prints and photographs divisionSubjectInfoFieldGlass negativesGenreInfoFieldGlass negatives phaphni idrbkarprbaetngphaph sunghmaykhwamwacaidrbkarepliynaeplngphaphtangcaktnchbb karprbprung image restoration tnchbbsamarthduidthini Prof Bohr LCCN2014715454 tif prbaetngphaphody Bammesk nikhuxphaphkhdsrrinwikiphiediyphasaxngkvs Featured pictures aela khux thuxwaepn phaphxyangidxyanghnungthidithisud thakhidwaiflnikhwrcaihkhwamsakhykbwikimiediykhxmmxnsepnxyangdi xyalngelthica esnxchux hakkhunmiphaphthimikhunphaph khlaykhlungkn thicasamarthephyaephridtam syyaxnuyatthiehmaasm ihaenicwa khunid xpohld kahndsyyaxnuyat aelaid esnxchuxaelw karxnuyatichsiththi Public domain Public domain false falseThis work is from the George Grantham Bain collection at the Library of Congress According to the library there are no known copyright restrictions on the use of this work Public domain Public domain false falsenganniepnsatharnsmbti inpraethstnkaenidaelapraethsxun thirayaewlakarkhumkhrxnglikhsiththinxykwa 70 pihlngcakphusrangsrrkhnganesiychiwit nganniepnsatharnsmbtiinshrthxemrika enuxngcakidrbkarephyaephr hruxkhuncdthaebiyntxsanknganlikhsiththiaehngshrth kxnwnthi 1 mkrakhm kh s 1929iflniidthukrabuwaimmikhxcakdphayitkdhmaylikhsiththi rwmthungsiththithiekiywkhxngaelathiiklekhiyngkn https creativecommons org publicdomain mark 1 0 PDM Creative Commons Public Domain Mark 1 0 false falsekhabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixairxngkvsNiels Bohr physicistixethmthiaesdngxyuiniflniprakxbdwy prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann wnthi ewlarupyxkhnadphuichkhwamehnpccubn12 56 23 kumphaphnth 25623 415 4 723 8 48 emkaibt more restoration08 30 20 kumphaphnth 25623 415 4 723 8 46 emkaibt more restoration08 56 18 kumphaphnth 25623 415 4 723 8 37 emkaibt User created page with UploadWizard hnathimiphaphni hnatxipni oyngmathiphaphni nils opr bthnaklsastrkhwxntm phuich Ponpan thdlxngekhiyn sthaniyxy prchya karichiflkhamokhrngkar wikixuntxipniichiflni karichbn ar wikipedia org بوابة فلسفة صورة مختارة بوابة فلسفة صورة مختارة 2 karichbn ca wikipedia org Bohri Niels Bohr Teoria atomica Fisica atomica karichbn cs wikipedia org Protonove cislo karichbn da wikipedia org Bruger Metalindustrien Kasse3 karichbn en wikipedia org Niels Bohr Wikipedia WikiProject Physics Portal Philosophy History of quantum mechanics Wikipedia WikiProject Military history Showcase Wikipedia WikiProject Military history Showcase FP Wikipedia WikiProject Philosophy Showcase Wikipedia WikiProject Physics Recognized content Portal Association football Recognised content Talk Niels Bohr Archive 2 Wikipedia Featured pictures People Science and engineering User talk Bammesk Archive 01 List of nonreligious Nobel laureates Wikipedia Featured pictures thumbs 63 Wikipedia Featured picture candidates Niels Bohr Wikipedia Featured picture candidates March 2019 Wikipedia Wikipedia Signpost 2019 03 31 Featured content Wikipedia Wikipedia Signpost Single 2019 03 31 Wikipedia WikiProject Military history News June 2019 Articles Wikipedia Picture of the day October 2021 Wikipedia WikiProject Military history Featured content Portal Sports Recognized content Template POTD 2021 10 07 Portal History Recognized content Wikipedia Main Page history 2021 October 7 User Carchasm sandbox philosophy karichbn en wikibooks org Planet Earth 3b Atoms Electrons Protons and Neutrons Planet Earth print version karichbn es wikipedia org Niels Bohr karichbn ha wikipedia org Niels Bohr karichbn hu wikipedia org Niels Bohr A kvantummechanika tortenete karichbn hy wikipedia org Նոբելյան մրցանակի անկրոնական դափնեկիրների ցանկ karichbn ja wikipedia org 利用者 訳由美子 翻訳中6 利用者 Ebeshi 1212 sandbox karichbn ko wikipedia org 닐스 보어 karichbn ml wikipedia org ന ൽസ ബ ർ karichbn nl wikibooks org Periodiek systeem Geschiedenis Bohr karichbn pt wikipedia org Niels Bohr Usuario NAMmc2 Testes Niels Bohr karichbn sl wikipedia org Uvod v kvantno mehaniko karichbn tl wikipedia org Padron Napiling Larawan Niels Bohr dukarichkhamokhrngkarephimetimkhxngiflnikhxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnnphuthayLibrary of Congresskhwamlaexiydaenwnxn800 dpikhwamlaexiydaenwtng800 dpisxftaewrthiichGIMP 2 10 8aekikhphaphlasud00 53 23 kumphaphnth 2562