ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkar khxmulekiywkbphaphkhnadkhxngtwxyangni 451 600 phikesl khwamlaexiydxun 180 240 phikesl 361 480 phikesl 577 768 phikesl 770 1 024 phikesl 1 539 2 048 phikesl 2 828 3 762 phikesl duphaphthimikhwamlaexiydsungkwa 2 828 3 762 phikesl khnadifl 5 38 emkaibt chnidimm image jpeg rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid nikhuxphaphkhdsrrinwikiphiediyphasaxngkvs Featured pictures aela khux thuxwaepn phaphxyangidxyanghnungthidithisud nikhuxphaphkhdsrrinwikiphiediyphasaturki Seckin resimler aela khux thuxwaepn phaphxyangidxyanghnungthidithisud thakhidwaiflnikhwrcaihkhwamsakhykbwikimiediykhxmmxnsepnxyangdi xyalngelthica esnxchux hakkhunmiphaphthimikhunphaph khlaykhlungkn thicasamarthephyaephridtam syyaxnuyatthiehmaasm ihaenicwa khunid xpohld kahndsyyaxnuyat aelaid esnxchuxaelw khaxthibayMount Rushmore2 jpg Construction at Mount Rushmore of George Washington s likeness wnthi circa 2474 hrux 2475 date QS P 1932 00 00T00 00 00Z 9 P1480 Q5727902 aehlngthima This image is available from the United States Library of Congress s Prints and Photographs division under the digital ID cph 3c21165 This tag does not indicate the copyright status of the attached work A normal copyright tag is still required See Commons Licensing العربية belaruskaya tarashkevica ব ল cestina Deutsch English espanol فارسی suomi francais galego עברית magyar Bahasa Indonesia italiano 日本語 lietuviu makedonski മലയ ള Nederlands polski portugues portugues do Brasil romană russkij sicilianu slovencina slovenscina Turkce ukrayinska 简体中文 繁體中文 phusrangsrrkh Rise Studio Rapid City S Dak Copyright not renewed karxnuyat karichiflniihm Public domain Public domain false falseThis work is in the public domain because it was published in the United States between 1929 and 1963 and although there may or may not have been a copyright notice the copyright was not renewed For further explanation see Commons Hirtle chart and the copyright renewal logs Note that it may still be copyrighted in jurisdictions that do not apply the rule of the shorter term for US works depending on the date of the author s death such as Canada 70 years p m a Mainland China 50 years p m a not Hong Kong or Macao Germany 70 years p m a Mexico 100 years p m a Switzerland 70 years p m a and other countries with individual treaties العربية Deutsch English espanol francais galego italiano 日本語 한국어 makedonski portugues portugues do Brasil russkij sicilianu slovenscina ukrayinska 简体中文 繁體中文 Flag of the United Statesewxrchnxun phaphni idrbkarprbaetngphaph sunghmaykhwamwacaidrbkarepliynaeplngphaphtangcaktnchbb karprbprung Cropped ink dirt and scratches removed Histogram adjusted tnchbbsamarthduidthini Mount Rushmore unrestored jpg khabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixairixethmthiaesdngxyuiniflniprakxbdwyphuekharchmxr prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann wnthi ewlarupyxkhnadphuichkhwamehnpccubn09 13 6 mkrakhm 25522 828 3 762 5 38 emkaibt Durova Information Description Construction at Mount Rushmore of George Washington s likeness Source Library of Congress http hdl loc gov loc pnp cph 3c21165 Date c1932 Author Rise Studio Rapid City S Dak Copyright not renewed Permission other hnathimiphaphni hnatxipni oyngmathiphaphni cxrc wxchingtn aemaebb Gallery aemaebb Gallery doc withiich phaph karichiflkhamokhrngkar wikixuntxipniichiflni karichbn ar wikipedia org قالب معرض الصور قالب معرض الصور شرح karichbn as wikipedia org স চ Gallery স চ Gallery doc karichbn bg wikipedia org Maunt Rshmor karichbn bh wikipedia org ट म पल ट Gallery ट म पल ट Gallery doc karichbn bn wikipedia org ট মপ ল ট চ ত রশ ল ট মপ ল ট চ ত রশ ল নথ স হ য য চ ত র karichbn ca wikipedia org Plantilla Galeria Plantilla Galeria us Usuari Jordiventura96 proves Some faces Colos estatua karichbn ckb wikipedia org داڕێژە Gallery داڕێژە Gallery doc karichbn cs wikipedia org Mount Rushmore Frantisek Micka karichbn dag wikipedia org Tɛmplet Gallery Tɛmplet Gallery doc Wikipedia Picture tutorial karichbn da wikipedia org Skabelon Gallery Skabelon Gallery doc karichbn diq wikipedia org Template Gallery doc Sablon Gallery karichbn el wikipedia org Protypo Gkaleri tekmhriwsh Protypo Gkaleri Syzhthsh protypoy Gkaleri karichbn en wikipedia org Wikipedia Unusual articles Mount Rushmore Help Pictures Template Gallery Portal United States Selected picture Legacy of George Washington Cultural depictions of George Washington User Jeremy Butler Things to Remember When Wikiing User Kaldari Sandbox Wikipedia April Fools Main Page Today s Featured Picture Archive 2009 Wikipedia Featured pictures History USA History Wikipedia WikiProject United States Government Construction of Mount Rushmore Wikipedia Featured pictures thumbs 14 Template Gallery doc Wikipedia Featured picture candidates January 2009 Wikipedia Featured picture candidates Construction at Mount Rushmore Wikipedia Wikipedia Signpost 2009 01 17 Features and admins User Panictook User talk Durova Archive 65 Wikipedia Picture of the day August 2009 Template POTD 2009 08 10 dukarichkhamokhrngkarephimetimkhxngiflnikhxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnnphuthayLibrary of Congresskarcdwangphaphpktikhwamlaexiydaenwnxn400 dpikhwamlaexiydaenwtng400 dpisxftaewrthiichAdobe Photoshop CS Windowsaekikhphaphlasud16 48 5 mkrakhm 2552sepssiimidprbethiyb