ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkar khxmulekiywkbphaphimmiphaphthimiraylaexiydsungkwani Matoug Adam JPG 225 316 phikesl khnadifl 59 kiolibt chnidimm image jpeg rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid khaxthibayMatoug Adam JPG English Libyan tourism minister Matoug Adam العربية وزير السياحة الليبي معتوق آدم الرقعي wnthi ph s 2511aehlngthima Libia al Hadeetha magazine via albakour com see file 1 phusrangsrrkh Unknown authorUnknown authorkarxnuyat karichiflniihm Public domain Public domain false falseThis work was first published on the Libya and is now in the public domain because its copyright protection has expired by virtue of the Copyright Protection Law enacted 1968 The work meets one of the following criteria It is an anonymous work or pseudonymous work and 25 years have passed since the date of its publication It is a work published after the death of the author and 50 have passed since the year of death of the author or last surviving author It is a photographic or cinematographic work that is not compositive artistic in nature and 5 years have elapsed since the end of the year of its publication It is a work created by a legal public or private entity and 30 years have passed since the year the work was created It is another type of work and than 25 years have elapsed since the the year of death of the author or last surviving author and fifty years have elapsed since the year of publication It is one of official documents such as texts of laws decrees regulations international agreements legal judgements and various official documents nxkcaknikhunxactxngephimpaysatharnsmbtiinshrthxemrika ephuxrabuwaehtuidngannicungepnsatharnsmbtiinshrthxemrika oprdthrabwangannixacimepnsatharnsmbtiinpraethsthiimidichkdrayaewlakhumkhrxnglikhsiththithisnkwa aelamikhxkahnddanlikhsiththithiyawnankwaxayukhxngphusrangsrrkhbwkipxik 60 pi odyechphaaxyangyingpraethsemksiok 100 pi caemka 95 pi okhlxmebiy 80 pi kwetmalaaelasamw 75 pi switesxraelndaelashrthxemrika 70 pi aelaewensuexla 60 pikhabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixairixethmthiaesdngxyuiniflniprakxbdwywnthisrang wnkxtng1968 prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann wnthi ewlarupyxkhnadphuichkhwamehnpccubn21 59 16 krkdakhm 2557225 316 59 kiolibt Information Description en 1 Libyan tourism minister Matoug Adam ar 1 وزير السياحة الليبي معتوق آدم الرقعي Source Libia al Hadeetha magazine via http www albakour com albakour com see fil hnathimiphaphni hnatxipni oyngmathiphaphni matxng xadm karichiflkhamokhrngkar wikixuntxipniichiflni karichbn ar wikipedia org معتوق آدم الرقعي karichbn en wikipedia org Matoug Adam karichbn simple wikipedia org Matoug Adam karichbn tr wikipedia org Matuk Adem karichbn www wikidata org Q63386275khxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnnkhwamehnphuichgd jpeg v1 0 using IJG JPEG v62 quality 100