ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkar khxmulekiywkbphaphkhnadkhxngtwxyangni 480 600 phikesl khwamlaexiydxun 192 240 phikesl 384 480 phikesl 614 768 phikesl 819 1 024 phikesl 1 600 2 000 phikesl duphaphthimikhwamlaexiydsungkwa 1 600 2 000 phikesl khnadifl 1 42 emkaibt chnidimm image jpeg rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid This is an image of a place or building that is listed on the National Register of Historic Places in the United States of America Its reference number is 82001192 khaxthibayManhattan at Dusk by slonecker jpg The Empire State Building wnthi 28 krkdakhm ph s 2548aehlngthima SXC 350175 http www sxc hu phusrangsrrkh Michael Sloneckerkarxnuyat karichiflniihm Slonecker s user profile Please feel free to modify and or use these uploads for any purpose whatsoever commercial or personal for profit or not for profit for print for web for print on demand for web templates for sale or distribution for whatever etc Confirmed by email slonecker earthlink net 2007 03 08 08 32 While I have not dedicated my photos into the public domain I have tried to make it clear that they could be used for any purpose whatsoever especially including derivative works ObjectPublic domain Public domain false falseUnited States copyright law does not protect architectural works before 1 thnwakhm ph s 2533 In 1990 the Architectural Works Copyright Protection Act amended subsection 102 a of the US copyright law by adding paragraph 8 architectural works A building that was substantially constructed or for which the plans were otherwise published before 1 thnwakhm ph s 2533 is in the public domain in the United States For images of architectural works in the United States completed on or after 1 thnwakhm ph s 2533 please use FoP US on the description pages of the images English espanol Deutsch italiano makedonski sicilianu slovenscina phaphthayphuthuxlikhsiththikhxngphlnganni xnuyatihnaphlnganniipichid inthukwtthuprasngkh odyimcakdenguxnikhdankarthasa karnaipichephuxkarkha aelakarddaeplngaekikhphlnganni hmayehtu hakrupphaphnicaepntxngrabuchuxphusrangsrrkhphlngan krunaich Attribution aethn hakrupphaphniepnkhxngthanexng krunaich PD self aethnCopyrighted free use Copyrighted free use false false khxkhwamxnuyatcakecakhxnglikhsiththiihichnganphaphhruxsuxni idrbkartrwcsxbaelw aelathukekbiwinxasasmkhrtxbklbxieml VRT odysahrbphuichthimibychi VRT samarthtrwcsxbbnthukekiywkbkhxkhwamxnuyatnnid inbnthukhmayelkh 2007040410008349 hakthantxngkarnaphaphhruxsuxniipichthixunnxkehnuxcakinmulnithiwikimiediy krunaxankhxmulekiywkbkarnaenuxhaipichnxkmulnithiwikimiediythihnani thngnihakthanprasngkhcakhxkhayunynekiywkbkarxnuyatihichichphaphhruxsuxni krunatidtxphuichthimibychi VRT hruxaecngphanhnaaecng VRT lingkkhxngbnthuk https ticket wikimedia org otrs index pl Action AgentTicketZoom amp TicketNumber 2007040410008349 Find other files from the same ticket phaphhruxsuxkhangtnni prakxbdwyphaphhruxsuxthithukbyytiihepnekhruxnghmaykarkha inhlayekhtxanacsal channkxnichngansuxni oprdaenicwathanidsuksakhxkdhmaythiekiywkhxngkbekhruxnghmaykarkhaihekhaic hakthanidplxmaeplnghruxkrathakarxunidthiepnkarlaemidsiththiinekhruxnghmaykarkha thancamikhwamrbphidthangkdhmayaetephiyngphuediyw sahrbraylaexiydephimetim duthi khaptiesthkhwamrbphidthangkdhmay karichphaphinhnaniimidrbrxngodylikhsiththi GFDL hrux CC BY SA 3 0 aelamiidhmaykhwamwaidrbkarrbrxngodyxngkhkrkhxngwikiphiediyhruxmulnithiwikimiediy hruxinthanxngediywkn paynimiichpayaesdngsthanalikhsiththi dngnnkarrabusthanalikhsiththicungtxngkrathaaeyktanghak duthi Commons Lincensingewxrchnxun iflxunthiichiflni Empire State Barnstar pngkhabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixairxitaliL Empire State Building e sullo sfondo il Chrysler Building costruiti in stile Art deco Alfioepxresiyنمایی از ساختمان امپایر استیت در جلوی ساختمان کرایسلر در شبixethmthiaesdngxyuiniflniprakxbdwytukexmiphrsettsthanalikhsiththimilikhsiththisyyaxnuyatcopyrighted free use xngkvsWikimedia VRTS ticket number xngkvs2007040410008349wnthisrang wnkxtng28 krkdakhm 2005bnthukphaphdwyCanon PowerShot S2 IS xngkvscoordinates of depicted place xngkvs40 44 53 002 N 73 59 10 000 Wlocation of creation xngkvsaemnaehttnexposure time xngkvs0 4 winathif number xngkvs3 5focal length xngkvs47 4 milliemtrmedia type xngkvsimage jpeg prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann wnthi ewlarupyxkhnadphuichkhwamehnpccubn02 06 15 tulakhm 25481 600 2 000 1 42 emkaibt Reverted to earlier revision11 48 18 singhakhm 25481 600 2 000 1 42 emkaibt Petrusbarbygereauteur slonecker There are no usage restrictions for this photo Source http sxc hu browse phtml f view amp id 350175 CopyrightedFreeUse hnathimiphaphni hnatxipni oyngmathiphaphni tukexmiphrsett wikiphiediy wnniinxdit 1 phvsphakhm wikiphiediy wnniinxdit phvsphakhm karichiflkhamokhrngkar wikixuntxipniichiflni karichbn ang wikipedia org Wikipǣdia Gecorene gemynddagas 1 THrimilcemonad karichbn an wikipedia org Empire State Building karichbn ar wikipedia org نيويورك مبنى إمباير ستيت قائمة أطول المباني في نيويورك بوابة نيويورك بوابة نيويورك معلم مختارة أرشيف بوابة نيويورك معلم مختارة 1 karichbn ast wikipedia org Nueva York Llista de los edificios mas altos d Estaos Xunios karichbn ba wikipedia org Empajr stejt bilding karichbn be tarask wikipedia org Abmerkavanne shablyonu Ci vedaece vy Arhiy 2 Vikipedyya Praekt Ci vedaece vy Arhiy 2010 Empajr Stejt Bildyng Vikipedyya Praekt Ci vedaece vy 2010 28 lyutaga 3 sakavika karichbn be wikipedia org Empajr Stejt Bildyng karichbn bg wikipedia org Potrebitel Biso Shablon Nachalna stranica 1 maj Spisk na naj visokite sgradi v sveta Uikipediya Izbrani godishnini Maj karichbn bn wikipedia org এম প য র স ট ট ব ল ড karichbn ca wikipedia org Nova York Empire State Building Llista dels 50 edificis mes alts de Nova York karichbn cs wikipedia org Seznam nejvyssich budov v New Yorku karichbn de wikipedia org Benutzer Penta Werbung Treppenlauf Laufwettbewerb Liste der National Historic Landmarks in New York City National Register of Historic Places in New York karichbn el wikipedia org Empair Steit Mpilntingk karichbn en wikipedia org 1931 National Register of Historic Places listings in New York User Porsche997SBS Images Portal Energy Selected picture Talk New York City Archive 7 Portal United States Anniversaries May Portal United States Anniversaries All Wikipedia talk WikiProject Cities Archive 6 Portal United States Anniversaries May May 1 User GoldenPhoenix Sandbox Wikipedia talk WikiProject Skyscrapers Archive 1 User JustbeBPMF Empire State Building List of New York City Designated Landmarks in Manhattan from 14th to 59th Streets User Beatlefan97 User Jhenderson777 User Presidentman potd 13 November 2009 User Jhenderson777 Intro Portal Energy Selected picture 29 Empire State User NYCRuss Sandbox New York City dukarichkhamokhrngkarephimetimkhxngiflnikhxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnnphuphlitklxngCanonrunkhxngklxngCanon PowerShot S2 ISewlaepidhnaklxng2 5 winathi 0 4 khaexff 3 5ewlathibnthukphaph20 31 28 krkdakhm 2548khwamyawofkselns47 4 mm karcdwangphaphpktikhwamlaexiydaenwnxn300 dpikhwamlaexiydaenwtng300 dpisxftaewrthiichAdobe Photoshop CS2 Windowsaekikhphaphlasud00 12 8 singhakhm 2548taaehnng Y aela Ckungklangrunexksif Exif 2 2ewlathiaeplngepndicithl20 31 28 krkdakhm 2548ohmdkarbibxdphaph5khwamerwchtetxr1 3125kharurbaesng A 3 625karchdechyaesng0rurbaesngkwangsud3 625 APEX f 3 51 ohmdkarwdaesngaephtethirnaeflchimichaeflch rangbichaeflchsepssisRGBkhwamlaexiydranabofks X11 520khwamlaexiydranabofks Y11 571 428571429hnwykhwamlaexiydranabofksniwwithikarwdesnesxrcudediywkarpramwlphaphophlessspktiohmdexksophechxrexksophechxrxtonmtiiwtbalansiwtbalansxtonmtidicithlsum1chnidsinaekhpecxraelndsekhp