ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkar khxmulekiywkbphaphkhnadkhxngtwxyangni 800 485 phikesl khwamlaexiydxun 320 194 phikesl 640 388 phikesl 1 024 620 phikesl 1 280 775 phikesl 2 560 1 550 phikesl 5 381 3 259 phikesl duphaphthimikhwamlaexiydsungkwa 5 381 3 259 phikesl khnadifl 7 54 emkaibt chnidimm image jpeg rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid Previous image Kirchspiel Rodder Mausescheune 2014 1 5 Next image enuxha 1 khwamyx 2 Assessment 3 karxnuyatichsiththi 4 Notes 5 rupthay khwamyx khaxthibayKirchspiel Rodder Mausescheune 2014 2915 19 jpg Deutsch Mausescheune Rodder Kirchspiel Dulmen Nordrhein Westfalen Deutschland English Mausescheune Rodder Kirchspiel Dulmen North Rhine Westphalia Germany Bosanski Misija stala u selu Rodder Kirchspiel kod Dulmena Sjeverna Rajna Vestfalija Njemacka Cestina Stodola zebezpecena proti mysim v Rodderu Kirchspiel Dulmen Severni Poryni Vestfalsko Nemecko Espanol Granero en Rodder Kirchspiel Dulmen Renania del Norte Westfalia Alemania Eesti Mausescheune Rodder Kirchspiel Dulmen Nordrhein Westfalen Saksamaa Francais nbsp La Grange aux Souris Mausescheune a Rodder hameau du village de Kirchspiel a Dulmen Rhenanie du Nord Westphalie en Allemagne Magyar Epiteszeti muemlek egerpajta egy dulmeni gazdasagban Az epulet kovekre helyezesevel vedtek meg a termest a ragcsaloktol Eszak Rajna Vesztfalia Nemetorszag Italiano Mausescheune fienile dei topi a Dulmen in Germania 한국어 독일 노르트라인베스트팔렌 뒬멘 뢰더 키르흐슈피엘 의 헛간 Plattduutsch Muusscheune Roder Kirchspiel Dulmen Nordrhein Westfalen Duutsland Nederlands Een muizenschuur in de Duitse stad Dulmen Polski Mausescheune Rodder Kirchspiel Dulmen Nadrenia Polnocna Westfalia Niemcy Portugues Celeiro na zona rural de Dulmen Renania do Norte Vestfalia Alemanha Russkij Myshinyj ambar v derevne Ryodder pod Dyulmenom Severnyj Rejn Vestfaliya Germaniya Ukrayinska Maushojne Redder Kirhshpil Dyulmen Pivnichnij Rejn Vestfaliya Nimechchina Barn Mausescheune nbsp nbsp chuxeruxng Mausescheune epn barn aela timber framed house xyuinekhtkarpkkhrxngkhxng Dulmen This image shows a heritage building in Germany located in the North Rhine Westphalian city Dulmen nbsp no nbsp 84 Mausescheune AddressInfoFieldMausescheune Kirchspiel Rodder 124 48249 Dulmen rthnxrthirn ewsthfaelin praethseyxrmni LocationInfoFieldRodder Kirchspiel Dulmen Coesfeld Munster Government Region rthnxrthirn ewsthfaelin praethseyxrmni thwipyuorp prakxbdwyInfoFieldMausescheune barn in Germany Technical SpecificationsInfoField21 nbsp mm f 10 3 10 nbsp s ISO nbsp 100 nbsp klxngthayphaphCanon EOS 70DelnsthayphaphEF S15 85mm f 3 5 5 6 IS USMkhwamyawofks21 nbsp mmExposure time3 10 nbsp saephnchxngrbaesngf 10khwamiwaesng ISOISO nbsp 100Image dataInfoField17 5 nbsp Mpx 5381 nbsp nbsp 3259 nbsp px nbsp khwamlaexiydphaph17 5 nbsp Mpxkhwamkwang nbsp nbsp khwamsung5381 nbsp nbsp 3259 nbsp pxPaper size300 nbsp dpi240 nbsp dpi150 nbsp dpi72 nbsp dpi50 nbsp dpi456 276 nbsp mm569 345 nbsp mm911 552 nbsp mm1898 1150 nbsp mm2734 1656 nbsp mmFile formatJPEG File Interchange FormatBit depth8 nbsp BitFile size7 5 nbsp MiBxtraswnlksna 5 3priphumisisRGBtone mapped from HDRI Assessmentswnthi Taken on nbsp 1 singhakhm ph s 2557 05 55 aehlngthima ngankhxngtw phusrangsrrkh Dietmar Rabich nbsp 1962 nbsp nbsp nbsp khaxthibay German amateur photographer wikipedian aela mathematician wnekid ph s 2505 nbsp sthanthiekid rthnxrthirn ewsthfaelin nbsp rayaewlasrangsrrkhngan from ph s 2518 date QS P 1975 00 00T00 00 00Z 7 P580 1975 00 00T00 00 00Z 9 sthanthisrangsrrkhngan Munsterland nordliches rwr ngankhwbkhumraykarhlkthan Q34788025 VIAF 8013659 ISNI 0000000397320168 Open Library OL6811772A GND 1052953328 Koninklijke 074527711 creator QS P170 Q34788025 karxnuyat karichiflniihm Dieser Text und viele andere auch sind ebenso in deutscher Sprache verfugbar Um diese sehen zu konnen wahle bitte auf dieser Webseite die Spracheinstellung Deutsch I Licence This photograph is protected by copyright law However it may be used for free by anyone provided it is used in accordance with the license Creative Commons License Attribution ShareAlike 4 0 International CC BY SA 4 0 These include among other things the naming of the author and the license as well as the setting of a link to the license text or its complete imprint The attribution should be done as follows Dietmar Rabich nbsp Wikimedia Commons nbsp Kirchspiel Rodder Mausescheune 2014 2915 19 nbsp CC nbsp BY SA nbsp 4 0 Please read the text of the license carefully before using the photograph If you do not agree with the conditions of the license or if you do not understand these conditions please refrain from using the photo If you have any questions regarding the license or the reuse of the image please contact me before using it If you do not comply with the terms of the license you do not acquire any right to use the image If you need another license to use please contact the author before using For informations about the licence see section karxnuyatichsiththi or as human readable summary or as full licence text at Creative Commons In addition to the above a link to the source nbsp so this page with the descriptions and license terms nbsp is appreciated More information or examples of use can be found at re use with example file The Attribution Generator is helpful in licensing matters Generate License Attribution nbsp As an alternative to the Creative Commons License CC BY SA 4 0 the Free Art License from version 1 3 may also be used II Fairness From printed materials and other tangible products that use that work the user is asked to send a copy to the author as thank you However this is not a condition for the use of the photo but a voluntary service The mailing address can be requested via the contact options Please note that the author had quite considerable effort to draw up this file Thus it is only fair to comply with the conditions of free licenses listed here In the case of violation of the license conditions the rights granted hereunder will expire automatically III Disclaimer Please note that the license applies solely for the reuse of the photograph itself The license doesn t grant you any right regarding the depicted object eg copyright or proprietary rights or the personality rights of the person eventually shown See licences and non copyright restrictions I do not grant any warranty that the subsequent use of the photograph is legally possible concerning the object or person shown in the photograph You are responsible to check and respect these rights in the publication in the respective medium or country The author is not responsible for the accuracy of the information contained herein description title etc Likewise the author assumes no liability for further use Please note the general disclaimer and please read reusing content outside Wikimedia too IV Contact E mail to the author or the author s talk page or the author s website ewxrchnxun duephim karaesdngthima caepntxngmitamsyyaxnuyat InfoFieldDietmar Rabich nbsp Wikimedia Commons nbsp Kirchspiel Rodder Mausescheune 2014 2915 19 nbsp CC nbsp BY SA nbsp 4 0 For print products Dietmar Rabich nbsp https commons wikimedia org wiki File Kirchspiel R C3 B6dder M C3 A4usescheune 2014 2915 19 jpg nbsp https creativecommons org licenses by sa 4 0 KeywordsInfoFieldAlemanha Alemania Allemagne Architectural element Architectural photography Architecture Architektur Architekturelement Architekturfotografie Available light Barn Bauernhof Bauwerk Bild des Tages Building Celeiro Contre jour Contre jour photography Dach Dammerung Denkmal Deutschland Door Duitsland Dulmen Exzellentes Bild Fachwerk Fachwerkhaus Featured picture Fotokunst Gable Gebaude Gegenlicht Germania Germany Giebel Haus HDR HDRI HDR Image HDR image High Dynamic Range Image Kirchspiel Kreis Coesfeld Kultur Kulturdenkmal Landwirtschaft Licht und Schatten Mausescheune Morgen Munsterland Nadrenia Polnocna Westfalia Natur Nemecko Nordrhein Westfalen North Rhine Westphalia Picture of the day Qualitatsbild Quality image ragcsalok Renania del Norte Westfalia Renania do Norte Vestfalia Rhenanie du Nord Westphalie Rodder Scheune Severni Poryni Vestfalsko Sjeverna Rajna Vestfalija Sommer Sonne Sonnenaufgang Sunrise Tone mapped HDR image Tur Westfalen Wiki Loves Monuments Zona rural 2014 OpenStreetMapInfoFieldWay 99088058 taaehnngkhxngwtthuhruxsthanthi51 nbsp 50 nbsp 08 29 nbsp ehnux 7 nbsp 22 nbsp 54 24 nbsp tawnxxk nbsp phaphniaelaphaphxun n sthanthiediywknthi OpenStreetMap51 835637 7 381733 taaehnngthitngklxng51 nbsp 50 nbsp 08 39 nbsp ehnux 7 nbsp 22 nbsp 53 92 nbsp tawnxxk nbsp phaphniaelaphaphxun n sthanthiediywknthi OpenStreetMap51 835663 7 381645 NOTE For this image at least three individual images were combined as a High Dynamic Range Image HDRI and tone mapping or as an exposure fusion pseudo HDRI and were thereby processed digitally Therefore this picture may not reflect reality exactly in every detail phaphthaynixpohldmaodyepnswnhnungkhxngkarprakwdphaphthay Wiki Loves Monuments 2014 Afrikaans nbsp Alemannisch nbsp العربية nbsp جازايرية nbsp azerbaycanca nbsp Bikol Central nbsp belaruskaya nbsp belaruskaya tarashkevica nbsp blgarski nbsp ব ল nbsp brezhoneg nbsp bosanski nbsp catala nbsp cestina nbsp Cymraeg nbsp dansk nbsp Deutsch nbsp Zazaki nbsp Ellhnika nbsp English nbsp Esperanto nbsp espanol nbsp eesti nbsp euskara nbsp فارسی nbsp suomi nbsp francais nbsp Frysk nbsp Gaeilge nbsp galego nbsp עברית nbsp ह न द nbsp hrvatski nbsp magyar nbsp հայերեն nbsp Bahasa Indonesia nbsp Ido nbsp italiano nbsp 日本語 nbsp ქართული nbsp 한국어 nbsp kyrgyzcha nbsp Letzebuergesch nbsp latviesu nbsp Malagasy nbsp makedonski nbsp മലയ ള nbsp Bahasa Melayu nbsp Malti nbsp norsk bokmal nbsp न प ल nbsp Nederlands nbsp norsk nynorsk nbsp norsk nbsp polski nbsp portugues nbsp portugues do Brasil nbsp romană nbsp russkij nbsp sicilianu nbsp davvisamegiella nbsp slovencina nbsp slovenscina nbsp shqip nbsp srpski srpski nbsp svenska nbsp ithy nbsp Tagalog nbsp Turkce nbsp ukrayinska nbsp اردو nbsp oʻzbekcha yzbekcha nbsp Yoruba nbsp 中文 nbsp 中文 中国大陆 nbsp 中文 简体 nbsp 中文 繁體 nbsp 中文 香港 nbsp 中文 臺灣 nbsp Assessment phaph of the day Quality phaph phaphniepn phaphpracawn emuxwnthi imthrabwn 2014 nikhuxphaphkhdsrrinwikimiediykhxmmxns Featured pictures aela khux thuxwaepn phaphxyangidxyanghnungthidithisud phaphniepnphaphkhunphaphtamhlkeknthkarphicarnaphaphkhunphaph hakkhunmiphaphthimikhunphaph khlaykhlungkn thicasamarthephyaephridtam syyaxnuyatthiehmaasm ihaenicwa khunid xpohld kahndsyyaxnuyat aelaid esnxchuxaelw phaphniidrbkarkhdsrrihepn phaphpracawn sahrbwnthi 4 thnwakhm ph s 2557 phaphdngklawmikhaxthibaydngtxipni English Mice barn in Rodder Kirchspiel Dulmen North Rhine Westphalia Germany phasaxun Bosanski Posebna stala zasticena od miseva na seoskom imanju Rodder Kirchspiel kod Dulmena Sjeverna Rajna Vestfalija Njemacka Cestina Specialni stodola chranena proti mysim ve vesnici Rodder pobliz mesta Dulmenu Severni Poryni Vestfalsko Nemecko Deutsch Mausescheune in der Bauerschaft Rodder Kirchspiel Dulmen Nordrhein Westfalen Deutschland English Mice barn in Rodder Kirchspiel Dulmen North Rhine Westphalia Germany Francais La Grange aux Souris Mausescheune a Rodder hameau du village de Kirchspiel a Dulmen Rhenanie du Nord Westphalie en Allemagne Italiano Mausescheune nel distretto di Rodder a Dulmen in Germania Magyar Egerpajta Dulmen Kirchspiel korzeteben a Rodder gazdasagnal A pajta hengeres es kiugro galleros koveken all igy a ragcsalokat tavol tartja a benne tarolt termenyektol Nemetorszag Eszak Rajna Vesztfalia Plattduutsch Muusscheune Roder Kirchspiel Dulmen Nordrhein Westfalen Duutsland한국어 독일 노르트라인베스트팔렌의 뒬멘 뢰더 키르크슈피엘 에 소재한 쥐 창고 中文 位于德国北莱茵 威斯特法伦州迪爾門的老鼠仓 karxnuyatichsiththi Dietmar Rabich inthanaphuthuxlikhsiththikhxngphaphhruxsuxni xnuyatihichphaphhruxsuxniphayitenguxnikhtxipni iflnixyuphayitsyyaxnuyat khriexthifkhxmmxns aebbaesdngthima xnuyataebbediywkn 4 0 nanachatikaraesdngthima Dietmar Rabichkhunsamarth thicaaebngpn thicathasaena aeckcay aelasngngandngklawtxip thicaeriyberiyngihm thicaddaeplngngandngklaw phayitenguxnikhtxipni aesdngthima khuntxngihekiyrtiecakhxngnganxyangehmaasm odyephimlingkipyngsyyaxnuyat aelarabuhakmikarepliynaeplng khunxacthaechnniidinrupaebbidkidtamkhwr aettxngimichinlksnathiaenawaphuihxnuyatsnbsnunkhunhruxkarichngankhxngkhun xnuyataebbediywkn hakkhunddaeplng epliynrup hruxtxetimnganni khuntxngichsyyaxnuyataebbediywknhruxaebbthiehmuxnkbsyyaxnuyatthiichkbnganniethannhttps creativecommons org licenses by sa 4 0 CC BY SA 4 0 Creative Commons Attribution Share Alike 4 0 true true Notes This image is not in the public domain Copyright protection applies The rules of the listed free license apply no more and no less Please respect the copyright protection Especially with social media you have to pay attention to the terms of use These sometimes do not correspond to the license conditions listed here See CC BY SA licenses and social media Please check this before use in the respective medium The license conditions must also be respected when using so called generative artificial intelligence AI Images created on the basis of this image are processed images or derivatives within the meaning of the license Of course a free license is no carte blanche for use In particular there are restrictions not based on the license for example to the personality rights of the author Copyright law of Germany nbsp 12 to 14 UrhG This is especially true for the required attribution and the use of the image It is expressly not allowed to give the impression through the use of the image that the author supports the work in which the image is used or whose rights holders in any way Links Creative Commons Namensnennung Share Alike 4 0 International Public License Section 2 a 6 No endorsement Section 2 b Other rights Wikimedia Commons Licensing Public Domain Wikipedia Copyright law Public DomainPlease do not change image file license or file name Even though a wiki offers many possibilities some changes are possible but not allowed The author of the image has made it available here precisely with the named license The three components image file license and file name title belong together indispensably Always keep in mind that images are also used outside the Wikimedia Commons world There the attribution refers to exactly this place and exactly this image file here If you want to make changes to the image and make this modified image available to others here upload the result under a new name and with the mention of your name as the editor Alternatively to the mentioned license only compatible licenses are allowed Otherwise any other form of licensing is reserved exclusively for the author When changing the filename please always consider the world outside of Wikimedia Commons If you enter a link you also expect that the matching page with the matching image appears Everything else leads to insecurities It should also be noted that the author expressly distance hisself from images based on his photos that have been changed nbsp even minimally nbsp by third parties and where only his name is noted as author Links Creative Commons Namensnennung Share Alike 4 0 International Public License Section 3 License Conditions Wikimedia Commons Licensing File renaming especially Which files should not be renamed Overwriting existing files Reusing content outside Wikimedia Ownership of pages and filesPlease do not overwrite this image with a modified image The author would like to make possible minor modifications only at his own source The source is usually a RAW file Processing of the JPEG file results in a loss of quality This ensures that the changes and the quality are preserved In addition easy access to the source should also be possible for external use which would not be possible via the file versions If you think that any changes should be required or if you want to express constructive criticism please contact the author Otherwise you can upload a new image with a new name Please use one of the templates derivative or extract Please be sure to include your name if you upload a derivative or a detail because you re in charge of the changes The preparation of derivatives or extracts is not allowed without mentioning your name Please do not rename this file The name is part of the required license informations In the case of misstatements the author is pleased to provide information Links Creative Commons Namensnennung Share Alike 4 0 International Public License Section 3 a Attribution Section 3 b Share alike Section 5 Disclaimer of Warranties and Limitation of Liability Wikimedia Commons Overwriting existing files rupthay You like this photograph That pleases me very much You would like to see more of my pictures With pleasure Wikimedia Commons has a large number of my photographs available under a free license This makes it easy for you and me The license details are for each picture The use is easier than you think because in essence this is just the attribution in the form I want In addition usage notes are listed for each picture And if it does not fit just ask My contact information is also available with every photograph All photographs Photographs with awards Photographs of North Rhine Westphalia Photographs of Germany Photographs of buildings Night shots Contre jourkhabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixairxngkvsMausescheune Rodder Kirchspiel Dulmen North Rhine Westphalia Germany 2014 eyxrmnMausescheune Rodder Kirchspiel Dulmen Nordrhein Westfalen Deutschland 2014 frngessLa Grange aux Souris Mausescheune a Rodder hameau du village de Kirchspiel a Dulmen Rhenanie du Nord Westphalie en Allemagne 2014 sepnGranero en Rodder Kirchspiel Dulmen Renania del Norte Westfalia Alemania 2014 xitaliMausescheune fienile dei topi a Dulmen in Germania 2014 hngkariEpiteszeti muemlek egerpajta egy dulmeni gazdasagban Az epulet kovekre helyezesevel vedtek meg a termest a ragcsaloktol Eszak Rajna Vesztfalia Nemetorszag 2014 ekahli독일 노르트라인베스트팔렌 뒬멘 뢰더 키르흐슈피엘 의 헛간 2014 bxseniy Misija stala u selu Rodder Kirchspiel kod Dulmena Sjeverna Rajna Vestfalija Njemacka 2014 oprtueksCeleiro na zona rural de Dulmen Renania do Norte Vestfalia Alemanha 2014 dtchEen muizenschuur in de Duitse stad Dulmen 2014 echkStodola zebezpecena proti mysim v Rodderu Kirchspiel Dulmen Severni Poryni Vestfalsko Nemecko 2014 rsesiy Myshinyj ambar v derevne Ryodder pod Dyulmenom Severnyj Rejn Vestfaliya Germaniya 2014 opaelndMausescheune Rodder Kirchspiel Dulmen Nadrenia Polnocna Westfalia Niemcy 2014 exsoteniyMausescheune Rodder Kirchspiel Dulmen Nordrhein Westfalen Saksamaa 2014 yuekhrnMaushojne Redder Kirhshpil Dyulmen Pivnichnij Rejn Vestfaliya Nimechchina 2014 eyxrmntaMuusscheune Roder Kirchspiel Dulmen Nordrhein Westfalen Duutsland 2014 raykarthiaesdngxyuiniflniprakxbdwyMausescheune nbsp xngkvswsduthiich loam nbsp xngkvswsduthiich lumber nbsp xngkvsdepicted part nbsp xngkvs pratufarmsunrise nbsp xngkvsyarungphusrangDietmar Rabich nbsp xngkvshnathikhxngwtthuphayitpraphcnni changphaphsthanalikhsiththimilikhsiththisyyaxnuyatCreative Commons Attribution ShareAlike 4 0 International nbsp xngkvsthimakhxngiflkarsrangdngedimodyphuxpohldlocation of creation nbsp xngkvsRodder nbsp xngkvswnthisrang wnkxtng1 singhakhm 2014ewla 05 55 nbsp xngkvsCommons quality assessment nbsp xngkvsWikipedia Picture of the day nbsp xngkvsn ewla 4 thnwakhm 2014Wikimedia Commons quality image nbsp xngkvsewlaerim 6 knyayn 2014Wikimedia Commons featured picture nbsp xngkvsewlaerim 29 knyayn 2014fabrication method nbsp xngkvsphaphchwngphlwtsungcontre jour nbsp xngkvsepnphaphthaysthanathangmrdkarchitectural heritage monument in North Rhine Westphalia nbsp xngkvsinventory number nbsp xngkvs 84xyuinekhtkarpkkhrxngkhxng Dulmen nbsp xngkvsswnprakxbthimikhunsmbtini Mausescheune nbsp xngkvsbnthukphaphdwyCanon EOS 70D nbsp xngkvsCanon EF S 15 85mm lens nbsp xngkvsxtraswnphaph5 3exposure time nbsp xngkvs0 3 winathif number nbsp xngkvs10ISO speed nbsp xngkvs100focal length nbsp xngkvs21 milliemtrmiswnrwminWiki Loves Monuments 2014 nbsp xngkvssthanthitng praethseyxrmnicoordinates of the point of view nbsp xngkvs51 50 8 N 7 22 54 Ecoordinates of depicted place nbsp xngkvs51 50 8 3 N 7 22 54 2 Emedia type nbsp xngkvsimage jpegkhwamkwang5 381 phikeslkhwamsung3 259 phikesldata size nbsp xngkvs7 902 116 ibtpraephtharchitectural photography nbsp xngkvschecksum nbsp xngkvsc6b1f2e71545b37992a5b4b0547492180e67a19dwithikarkahnd SHA 1hwkhxhlkMausescheune nbsp xngkvsaehchaethkSonnenaufgangSunriseContreJourHDRIHighDynamicRangeImageArchitecturalPhotographyMausescheunelighting nbsp xngkvssunrise nbsp xngkvsOpenStreetMap way ID nbsp xngkvs99088058 prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann wnthi ewlarupyxkhnadphuichkhwamehn pccubn16 45 27 phvscikayn 25595 381 3 259 7 54 emkaibt XRayresolution 16 21 7 singhakhm 25584 608 2 791 5 41 emkaibt XRayFix EXIF 23 33 13 phvsphakhm 25584 608 2 791 5 42 emkaibt XRayFix LR6 EOS70D magenta 22 16 22 knyayn 25574 000 2 423 4 28 emkaibt XRayresolution 20 14 5 knyayn 25573 200 1 938 2 96 emkaibt XRaysmall fixes halos 22 32 2 knyayn 25573 200 1 938 2 96 emkaibt XRayCAs removed wire removed 03 24 2 knyayn 25573 200 1 938 2 91 emkaibt XRayVicunaUploader 1 20 hnathimiphaphni immihnaidoyngmathiphaphnikarichiflkhamokhrngkar wikixuntxipniichiflni karichbn bn wikipedia org উইক প ড য আজক র ন র ব চ ত ছব ড স ম বর ২০১৪ karichbn ca wikiquote org Graner karichbn crh wikipedia org Sablon Potd 2014 12 karichbn cv wikipedia org Shablon Potd 2014 12 karichbn de wikipedia org Hiddingsel Benutzer XRay Bilder Wikipedia Wiki Loves Monuments 2014 Deutschland Bildnutzung6 karichbn dsb wikipedia org Wikipedija Wobraze tyzenja 2015 Wikipedija Wobraze tyzenja 2016 karichbn en wikipedia org Wikipedia Featured picture candidates September 2014 Wikipedia Featured picture candidates Set The Fog karichbn fr wikipedia org Dulmen karichbn ha wikipedia org Gona karichbn hsb wikipedia org Wikipedija Wobrazy tydzenja 2015 Wikipedija Wobrazy tydzenja 2016 Wikipedija Wobrazy tydzenja 2017 karichbn hu wikipedia org Wikipedia Kezdolapmuhely A nap kepe 2014 12 Wikipedia A nap kepe 2014 12 karichbn it wiktionary org fienile karichbn ka wikipedia org თარგი Potd 2014 12 karichbn ko wikipedia org 위키백과 오늘의 그림 2014년 12월 karichbn krc wikipedia org Shablon Potd 2014 12 karichbn lbe wikipedia org Shablon Potd 2014 12 karichbn os wikipedia org Huyzaeg Potd 2014 12 karichbn pt wikipedia org Wikipedia Imagem em destaque Dezembro de 2014 Wikipedia Imagem em destaque 4 de dezembro de 2014 karichbn ru wikipedia org Shablon Potd 2014 12 karichbn ru wikinews org Shablon Potd 2014 12 karichbn sah wikipedia org Halyyp Potd 2014 12 karichbn stq wikipedia org Wikipedia Bielden fon ju Wiek 2015 karichbn tt wikipedia org Kalyp Potd 2014 12 karichbn uk wikipedia org Shablon Potd 2014 12 karichbn vi wikipedia org Thanh vien Phương Huy Phong cảnh Chọn lọc karichbn www wikidata org Q63699866 karichbn xal wikipedia org Kevlәr Potd 2014 12 karichbn zh wikipedia org Wikipedia 每日图片 2014年12月 Wikipedia 每日图片 2014年12月4日khxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnnchuxphaphLuminance HDR 2 3 1 tonemapping parameters Operator Fattal Parameters Alpha 1 Beta 0 9 Color Saturation 1 Noise Reduction 0 PreGamma 1phuphlitklxngCanonrunkhxngklxngCanon EOS 70DphuthayDietmar Rabichewlaepidhnaklxng3 10 winathi 0 3 khaexff 10xtrakhwamerw ISO100ewlathibnthukphaph05 55 1 singhakhm 2557khwamyawofkselns21 mm khwamehnphuichLuminance HDR 2 3 1 tonemapping parameters Operator Fattal Parameters Alpha 1 Beta 0 9 Color Saturation 1 Noise Reduction 0 PreGamma 1laticud51 50 8 39 Nlxngcicud7 22 53 92 EpaychlakKirchspiel Rodder MausescheunechuxeruxngsnKirchspiel Rodder MausescheunephuthrnglikhsiththiDietmar Rabich DulmenemuxngthiaesdngDulmenkhwamlaexiydaenwnxn300 dpikhwamlaexiydaenwtng300 dpisxftaewrthiichAdobe Photoshop Lightroom 6 7 Windows aekikhphaphlasud10 34 27 phvscikayn 2559opraekrmexksophechxrkahndrurbaesngepnhlk a runexksif Exif 2 3ewlathiaeplngepndicithl05 55 1 singhakhm 2557khwamerwchtetxr1 736966kharurbaesng A 6 643856karchdechyaesng0ohmdkarwdaesngaephtethirnaeflchimichaeflch rangbichaeflchsepssisRGBohmdexksophechxraebrkektxtonmtichnidsinaekhpecxrpktirunciphiexsaethk0 0 2 2hmayelkhsieriylkhxngklxng073024007062elnsthiichEF S15 85mm f 3 5 5 6 IS USMwnthiaekikhkhxmulemtalasud11 34 27 phvscikayn 2559ID echphaakhxngexksartnchbbDF7558E5A77BE4792761E842BB3B10B9sthanalikhsiththimilikhsiththikhasakhyBauwerk Bauwerke Deutschland Dulmen Gebaude Germany HDR Image HDRI Haus High Dynamic Range Image Hauser Kirchspiel Kreis Coesfeld Mausescheune Munsterland Nordrhein Westfalen North Rhine Westphalia RodderkhxmulsahrbtidtxDulmen DeutschlandcnghwdhruxrththiaesdngNordrhein WestfalenpraethsthiaesdngDeutschlandrhssahrbpraethsthiaesdngDErun IIM4 ekhathungcak https th wikipedia org wiki ifl Kirchspiel Rodder Mausescheune 2014 2915 19 jpg