ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkar khxmulekiywkbphaphkhnadkhxngtwxyangni 800 535 phikesl khwamlaexiydxun 320 214 phikesl 640 428 phikesl 1 087 727 phikesl duphaphthimikhwamlaexiydsungkwa 1 087 727 phikesl khnadifl 203 kiolibt chnidimm image jpeg rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid khwamyx khaxthibayQuartier dit indigene hanoi jpg Francais Le quartier des 36 rues vu de la cathedrale a l epoque de la colonisation francaise wnthi During the French Colonial period so no later than 1945aehlngthima https www flickr com photos 13476480 N07 collections 72157629954167739 phusrangsrrkh Auteurs inconnusewxrchnxun https www flickr com photos 13476480 N07 5095910714 in album 72157625195491842 https www flickr com photos 13476480 N07 5061104909 in album 72157625118420698 karxnuyatichsiththi Public domain Public domain false falseThis work is in the public domain in Vietnam for one of the following reasons It is a cinematographic work photographic work work of applied art or anonymous work first published more than 75 years ago See Commons Copyright rules by territory Vietnam It is a cinematographic work photographic work dramatic work work of applied art or anonymous work first published more than 50 years prior to January 1 2010 It is another type of work and the creator died more than 50 years ago To uploader Please provide where the image was first published and who created it nxkcaknikhunxactxngephimpaysatharnsmbtiinshrthxemrika ephuxrabuwaehtuidngannicungepnsatharnsmbtiinshrthxemrika oprdthrabwangannixacimepnsatharnsmbtiinpraethsthiimidichkdrayaewlakhumkhrxnglikhsiththithisnkwa aelamikhxkahnddanlikhsiththithiyawnankwaxayukhxngphusrangsrrkhbwkipxik 60 pi odyechphaaxyangyingpraethsemksiok 100 pi caemka 95 pi okhlxmebiy 80 pi kwetmalaaelasamw 75 pi switesxraelndaelashrthxemrika 70 pi aelaewensuexla 60 pi Deutsch English espanol francais Bahasa Melayu Tiếng Việt മലയ ള 日本語 中文 中文 简体 中文 繁體 khabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixairfrngessLe quartier des 36 rues vu de la cathedrale a l epoque de la colonisation francaise ixethmthiaesdngxyuiniflniprakxbdwysthanalikhsiththimilikhsiththisyyaxnuyatCreative Commons Attribution ShareAlike 4 0 International xngkvswnthisrang wnkxtng12 minakhm 2010media type xngkvsimage jpeg prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann wnthi ewlarupyxkhnadphuichkhwamehnpccubn11 53 16 emsayn 25631 087 727 203 kiolibt Uploaded a work by Auteurs inconnus from https www flickr com photos 13476480 N07 collections 72157629954167739 with UploadWizard hnathimiphaphni hnatxipni oyngmathiphaphni hanxy karichiflkhamokhrngkar wikixuntxipniichiflni karichbn fr wikipedia org Hanoi karichbn sl wikipedia org Hanojkhxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnnkhwamkwang1 221 phikeslkhwamsung800 phikeslbittxkhxmophennt8 8 8phikeslkhxmophsichnRGBkarcdwangphaphpkticanwnkhxmophennt3khwamlaexiydaenwnxn72 dpikhwamlaexiydaenwtng72 dpisxftaewrthiichAdobe Photoshop CC 2015 Macintosh aekikhphaphlasud11 49 16 emsayn 2563runexksif Exif 2 21sepssiimidprbethiybID echphaakhxngexksartnchbbuuid F7945CA855BDDF11AA3BCE40CAFC9ADAewlathiaeplngepndicithl10 22 12 minakhm 2553wnthiaekikhkhxmulemtalasud18 49 16 emsayn 2563sthanalikhsiththiimidkahndsthanalikhsiththirun IIM2