ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkar khxmulekiywkbphaphkhnadkhxngtwxyangni 800 533 phikesl khwamlaexiydxun 320 213 phikesl 640 427 phikesl 1 024 683 phikesl 1 280 853 phikesl 1 800 1 200 phikesl duphaphthimikhwamlaexiydsungkwa 1 800 1 200 phikesl khnadifl 1 62 emkaibt chnidimm image jpeg rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid khwamyx M203 Grenade manipulated by an US soldier source nbsp https web archive org web 20070625002019if https peosoldier army mil images sw M203 171 jpg karxnuyatichsiththi Public domain Public domain false false This file is a work of a U S Army soldier or employee taken or made as part of that person s official duties As a work of the U S federal government it is in the public domain in the United States العربية nbsp ব ল nbsp catala nbsp cestina nbsp Deutsch nbsp English nbsp espanol nbsp eesti nbsp فارسی nbsp suomi nbsp francais nbsp hrvatski nbsp magyar nbsp Bahasa Indonesia nbsp italiano nbsp 日本語 nbsp 한국어 nbsp lietuviu nbsp makedonski nbsp മലയ ള nbsp မ န မ ဘ သ nbsp Nederlands nbsp polski nbsp portugues nbsp russkij nbsp sicilianu nbsp srpski srpski nbsp Turkce nbsp ukrayinska nbsp Tiếng Việt nbsp 中文 简体 nbsp 中文 繁體 nbsp khabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixairraykarthiaesdngxyuiniflniprakxbdwysthanalikhsiththisatharnsmbtiichkbekhtxanacsal shrthwithikarkahnd work of the federal government of the United States nbsp xngkvsISO speed nbsp xngkvs100exposure time nbsp xngkvs0 008 winathif number nbsp xngkvs18focal length nbsp xngkvs25 milliemtr prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann wnthi ewlarupyxkhnadphuichkhwamehn pccubn07 23 11 mithunayn 25501 800 1 200 1 62 emkaibt Chico75M203 Grenade manipulated by an US soldier source https peosoldier army mil images sw M203 171 jpg hnathimiphaphni immihnaidoyngmathiphaphnikarichiflkhamokhrngkar wikixuntxipniichiflni karichbn fr wikipedia org M203 lance grenades karichbn no wikipedia org M203khxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnnphuphlitklxngCanonrunkhxngklxngCanon EOS 1Ds Mark IIewlaepidhnaklxng1 125 winathi 0 008 khaexff 18xtrakhwamerw ISO100ewlathibnthukphaph12 24 9 phvsphakhm 2548khwamyawofkselns25 mm karcdwangphaphpktikhwamlaexiydaenwnxn300 dpikhwamlaexiydaenwtng300 dpisxftaewrthiichAdobe Photoshop CS2 Macintoshaekikhphaphlasud18 25 2 emsayn 2549taaehnng Y aela Ckungklangopraekrmexksophechxrtngkhaexngrunexksif Exif 2 21ewlathiaeplngepndicithl12 24 9 phvsphakhm 2548khwamerwchtetxr7kharurbaesng A 8 375karchdechyaesng0ohmdkarwdaesngaephtethirnaeflchimichaeflch rangbichaeflchsepssisRGBkhwamlaexiydranabofks X3 526 7605633803khwamlaexiydranabofks Y3 528 0423280423hnwykhwamlaexiydranabofksniwkarpramwlphaphophlessspktiohmdexksophechxrexksophechxrtngkhaexngiwtbalansiwtbalanstngkhaexngchnidsinaekhpecxrpkti ekhathungcak https th wikipedia org wiki ifl M203 171 jpg