ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkar khxmulekiywkbphaphkhnadkhxngtwxyang PNG nikhxngifl SVG ni 717 471 phikesl khwamlaexiydxun 320 210 phikesl 640 420 phikesl 1 024 673 phikesl 1 280 841 phikesl 2 560 1 682 phikesl duphaphthimikhwamlaexiydsungkwa ifl SVG 717 471 phikesl khnadifl 412 kiolibt rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid khwamyx khaxthibayGovernment of Kerala Logo svg Emblem Logo of Keralawnthi 3 mkrakhm ph s 2554aehlngthima https kerala gov inphusrangsrrkh Government of Kerala karxnuyatichsiththi Public domain Public domain false falseThis work is in the public domain in India because its term of copyright has expired The Indian Copyright Act applies in India to works first published in India According to the Indian Copyright Act 1957 as amended up to Act No 27 of 2012 Chapter V Section 25 Anonymous works photographs cinematographic works sound recordings government works and works of corporate authorship or of international organizations enter the public domain 60 years after the date on which they were first published counted from the beginning of the following calendar year i e as of 2024 works published prior to 1 January 1964 are considered public domain Posthumous works other than those above enter the public domain after 60 years from publication date counted from the beginning of the following calendar year Any kind of work other than the above enters the public domain 60 years after the author s death or in the case of a multi author work the death of the last surviving author counted from the beginning of the following calendar year Text of laws judicial opinions and other government reports are free from copyright The Indian Copyright Act 1957 is not retroactive so any work in which copyright did not subsist when it commenced did not have its copyright restored and is in the public domain per the Copyright Act 1911 nxkcaknikhunxactxngephimpaysatharnsmbtiinshrthxemrika ephuxrabuwaehtuidngannicungepnsatharnsmbtiinshrthxemrika oprdthrabwangannixacimepnsatharnsmbtiinpraethsthiimidichkdrayaewlakhumkhrxnglikhsiththithisnkwa aelamikhxkahnddanlikhsiththithiyawnankwaxayukhxngphusrangsrrkhbwkipxik 60 pi odyechphaapraethsemksiok 100 pi caemka 95 pi okhlxmebiy 80 pi kwetmalaaelasamw 75 pi switesxraelndaelashrthxemrika 70 pi العربي ة ব ল Deutsch English francais ह न द italiano 日本語 ಕನ ನಡ makedonski മലയ ള मर ठ Nederlands portugues do Brasil sicilianu தம ழ ತ ಳ اردو 繁體中文 phaphniepnphaphthng traxarm traaephndin traprathb traphaphphimph tlxdcnekhruxnghmaykhxngthangkarxun sungkarichnganekhruxnghmaydngklawthukcakdaelakhwbkhumodykdhmayxun thiaeykipcakkdhmaylikhsiththiinhlaypraethskhabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixairsepnEmblem of Kerala IndiaixethmthiaesdngxyuiniflniprakxbdwysthanalikhsiththimilikhsiththisyyaxnuyatCreative Commons Attribution ShareAlike 4 0 International xngkvsCommons quality assessment xngkvsWikimedia Commons quality image xngkvsthimakhxngiflkarsrangdngedimodyphuxpohldwnthisrang wnkxtng3 mkrakhm 2011media type xngkvsimage svg xml prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann lasud du ihmkwa 10 10 wnthi ewlarupyxkhnadphuichkhwamehnpccubn16 11 20 krkdakhm 2566717 471 412 kiolibt Reverted to version as of 09 00 26 June 2023 UTC 15 20 28 mithunayn 25661 000 651 404 kiolibt Reverted to version as of 09 10 27 July 2022 UTC 16 00 26 mithunayn 2566717 471 412 kiolibt Improve English text21 28 15 singhakhm 2565717 471 392 kiolibt Original version18 14 15 singhakhm 25651 000 651 404 kiolibt Proper version10 45 30 krkdakhm 2565717 471 392 kiolibt Better version16 10 27 krkdakhm 25651 000 651 404 kiolibt https gad kerala gov in history state emblem If you enlarge the tiny image the emblem is shown in black This is an official governemnt site explaining the emblem19 33 10 mithunayn 2565717 471 392 kiolibt Reverted to version as of 13 21 15 May 2022 UTC 16 17 2 mithunayn 25651 052 744 332 kiolibt Kerala government is not like Karnataka government Most of the websites use red The original coloured version is neither red nor black 21 43 30 phvsphakhm 25651 000 651 404 kiolibt ChiKReverted to version as of 11 34 27 May 2022 UTC from https kerala gov in lasud du ihmkwa 10 10 hnathimiphaphni hnatxipni oyngmathiphaphni rthekrla karichiflkhamokhrngkar wikixuntxipniichiflni karichbn af wikipedia org Kerala karichbn ar wikipedia org كيرلا ويكيبيديا مقالة الصفحة الرئيسية المختارة 67 karichbn as wikipedia org ক ৰ ল ৰ জ য karichbn bn wikipedia org ভ রত র র জ য প রত ক র ত ল ক ক রল র প রত ক karichbn en wikipedia org All India Anna Dravida Munnetra Kazhagam Oommen Chandy List of governors of Kerala Kerala Legislative Assembly P J Joseph T M Thomas Isaac K M Mani Vagamon Kerala Thiruvanchoor Radhakrishnan Kattappana Government of Kerala Politics of Kerala G Sudhakaran Emblem of Kerala Shibu Baby John Kadannappalli Ramachandran A K Balan A P Anil Kumar Adoor Prakash M K Muneer List of chief ministers of Kerala Mathew T Thomas Kerala Public Works Department Second Chandy ministry K P Mohanan Department of Revenue and Land Survey V S Sivakumar P K Abdu Rabb K C Joseph Irikkur politician C N Balakrishnan K Babu P K Jayalakshmi Department of Industries Kerala Department of General Education Anoop Jacob Manjalamkuzhi Ali C Raveendranath Emerging Kerala V S Sunil Kumar K T Jaleel User Wikiuser13 sandbox Template Second Chandy ministry List of constituencies of the Kerala Legislative Assembly dukarichkhamokhrngkarephimetimkhxngiflnikhxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnnkhwamkwang716 5pxkhwamsung470 5px