ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkar khxmulekiywkbphaphkhnadkhxngtwxyang PNG nikhxngifl SVG ni 302 502 phikesl khwamlaexiydxun 144 240 phikesl 289 480 phikesl 462 768 phikesl 616 1 024 phikesl 1 232 2 048 phikesl duphaphthimikhwamlaexiydsungkwa ifl SVG 302 502 phikesl khnadifl 53 kiolibt rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid khwamyx khaxthibayBadge of the Malaysian Army svg Crest of the Malaysian Armywnthi 23 emsayn ph s 2555 05 28 UTC aehlngthima This file was derived from Flag of the Malaysian Army svg phusrangsrrkh Flag of the Malaysian Army svg Syed derivative work Syed derivative work Fry1989 karxnuyatichsiththi Public domain Public domain false falsenganniidthukephyaephrsusatharnsmbtiodyecakhxng Syed thi wikiphiediyphasaxngkvs sungmiphlthwolk inbangpraeths karkrathadngklawxacimsamarththaidtamkdhmay Syed xnuyatihthukkhnmisiththiinkarichiflniinthukehtuphlkarich odyimmimienguxnikh ewnaetkdhmayimxnuyatihthaechnnnPublic domain Public domain false falsePublic domain Public domain false falseThis work is in the public domain in Malaysia because either its term of copyright has expired or the work is legally exempted from copyright The Malaysian Copyright Act 1987 applies to works first published in Malaysia details The periods of copyright are as follows For literary musical or artistic works copyright subsists for 50 years after the death of the author Copyright for unpublished works subsists for 50 years after the publication For anonymous or pseudonymous works copyright subsists for 50 years after publication unless the author is made known For films and sound recordings copyright subsists for 50 years after publication For unpublished sound recordings copyright subsists for 50 years after the fixation For broadcasts copyright subsists for 50 years after the broadcast is first made Works by the government governmental organisations and international organisations are subject to copyright for 50 years after publication sections 11 and 23 Regardless of the above the texts of laws judicial opinions and government reports are always free from copyright section 3 definition of literary work All 50 year durations are computed from the beginning of the calendar year next following the year in which the work was first published or made In other words as of 2024 works published prior to 1 January 1974 are now in the public domain nxkcaknikhunxactxngephimpaysatharnsmbtiinshrthxemrika ephuxrabuwaehtuidngannicungepnsatharnsmbtiinshrthxemrika oprdthrabwangannixacimepnsatharnsmbtiinpraethsthiimidichkdrayaewlakhumkhrxnglikhsiththithisnkwa aelamikhxkahnddanlikhsiththithiyawnankwaxayukhxngphusrangsrrkhbwkipxik 60 pi odyechphaaxyangyingpraethsemksiok 100 pi caemka 95 pi okhlxmebiy 80 pi kwetmalaaelasamw 75 pi switesxraelndaelashrthxemrika 70 pi aelaewensuexla 60 pi Uploaded with derivativeFX pumkarxpohldtnchbb The original description page was here All following user names refer to en wikipedia 2012 03 24 15 26 Syed 241 402 48258 bytes Uploading a non free logo using Wikipedia File Upload Wizard File Upload Wizard khabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixairixethmthiaesdngxyuiniflniprakxbdwysthanalikhsiththicopyrighted dedicated to the public domain by copyright holder xngkvssyyaxnuyatreleased into the public domain by the copyright holder xngkvswnthisrang wnkxtng23 emsayn 2012media type xngkvsimage svg xmlchecksum xngkvs5c58fa38ac1b7beb94cb5718d852840c80d34b86withikarkahnd SHA 1 xngkvsdata size xngkvs54 027 ibtkhwamsung502 phikeslkhwamkwang302 phikesl prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann wnthi ewlarupyxkhnadphuichkhwamehnpccubn11 57 26 emsayn 2557302 502 53 kiolibt 白布飘扬enlarge11 51 26 emsayn 2557181 301 53 kiolibt 白布飘扬Enlarge minor adjustment of the default size 03 39 11 phvsphakhm 255557 95 53 kiolibt BOT Reverting to most recent version before archival03 39 11 phvsphakhm 2555241 402 47 kiolibt BOT Uploading old version of file from en wikipedia originally uploaded on 2012 03 24 15 26 09 by Syed08 29 3 phvsphakhm 255557 95 53 kiolibt Fry1989update12 29 23 emsayn 255557 95 51 kiolibt Fry1989 int filedesc Information Description Crest of the Malaysian Army Source Derived from Flag of the Malaysian Army svg display 50 Date 2012 04 23 05 28 UTC Author File Flag of the Malaysian Army svg File Malaysian Army Fl hnathimiphaphni hnatxipni oyngmathiphaphni kxngthphmaelesiy karichiflkhamokhrngkar wikixuntxipniichiflni karichbn bn wikipedia org ম লয শ য স ন ব হ ন karichbn de wikipedia org Malaysisches Heer karichbn en wikipedia org 13 May incident Royal Malay Regiment Royal Ranger Regiment Malaysian Army Rejimen Askar Wataniah 10th Parachute Brigade Malaysia Royal Artillery Regiment Malaysia Malaysian Army Aviation Royal Signals Regiment Malaysia Royal Intelligence Corps Royal Army Engineers Regiment Malaysia Royal Military Police Corps Malaysia Corps of Royal Electrical amp Mechanical Engineers Malaysia Kor Agama Angkatan Tentera Royal Armoured Corps Malaysia Template Malaysian Army Royal Ordnance Corps Malaysia Rejimen Sempadan List of equipment of the Malaysian Army Battle of Semur River List of equipment of the Malaysian Armed Forces Malaysian Army Training and Doctrine Command Chief of Army Malaysia 3rd Infantry Division Malaysia 21st Special Service Group 11th Strategic Division Malaysia MALBATT Misi Bakara User 立花宮は sandbox karichbn fa wikipedia org نیروی زمینی مالزی karichbn fi wikipedia org Malesian maavoimat karichbn id wikipedia org Pasukan Gerak Khas Resimen Tentara Wataniah Resimen Ranger Kerajaan Resimen Tentara Kerajaan Melayu Angkatan Darat Malaysia Resimen Perbatasan Brigade 10 Para Templat Angkatan Darat Malaysia Panglima Angkatan Darat Malaysia Korps Kavaleri Kerajaan Grup Gerak Khas Korps Polisi Militer Kerajaan Resimen Artileri Kerajaan Tunku Osman karichbn it wikipedia org Tentera Darat Malaysia karichbn ms wikipedia org Tentera Darat Malaysia Tentera Laut Diraja Malaysia Rejimen Askar Wataniah dukarichkhamokhrngkarephimetimkhxngiflnikhxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnnkhwamkwang301 59546khwamsung501 76334