ifl prawtiifl hnathimiphaphni karichiflkhamokhrngkar khxmulekiywkbphaphimmiphaphthimiraylaexiydsungkwani Alexandre Roslin Le Dauphin Louis de France MV 5419 jpg 468 589 phikesl khnadifl 30 kiolibt chnidimm image jpeg rupphaphhruxiflesiyngni tnchbbxyuthi khxmmxns raylaexiyddanlang epnkhxkhwamthiaesdngphlcak ifltnchbbinkhxmmxns khxmmxnsepnewbistinokhrngkarsahrbekbrwbrwmsuxesri thi khunsamarthchwyid khwamyx Alexander Roslin The Dauphin Louis of France 1729 1765 son of Louis XV silpin phusrangsrrkhngan Alexander Roslin 1718 1793 khaxthibay Swedish citrkr portraitist aela visual artistwnekid wnesiychiwit 15 krkdakhm ph s 2261 5 krkdakhm ph s 2336 sthanthiekid sthanthiesiychiwit Malmo Sankt Petri forsamlingparisrayaewlasrangsrrkhngan 1740s date QS P 1740 00 00T00 00 00Z 8 2333 hrux 2334sthanthisrangsrrkhngan ibrxyth paris esntpietxsebirkngankhwbkhumraykarhlkthan Q315102 VIAF 76584639 ISNI 0000000122821043 ULAN 500032508 Open Library OL5143054A LCCN n96123864 WorldCat creator QS P170 Q315102 chuxeruxng frngess Louis de France 1729 1765 fils de Louis XV The Dauphin Louis of France 1729 1765 son of Louis XVtitle QS P1476 fr Louis de France 1729 1765 fils de Louis XV label QS Lfr Louis de France 1729 1765 fils de Louis XV label QS Len The Dauphin Louis of France 1729 1765 son of Louis XV Object type citrkrrm praephth phaphehmuxn Depicted people ecachayhluys odaefngaehngfrngess wnthi 2307 hrux 2308 suxthiephyaephr pastel on parchment khnad khwamsung 57 0 cm khwamkwang 46 9 cm dimensions QS P2048 57U174728dimensions QS P2049 46 9U174728karekbrwbrwm Museum of the History of France chuxinphasatnchbb Musee de l Histoire de Francehnwynganaem phrarachwngaewrsaythitng aewrsayphikd 48 48 15 84 ehnux 2 07 19 09 tawnxxk cdtngkhunemux 2375 hrux 2376ewbist www museehistoiredefrance frngankhwbkhumraykarhlkthan Q3329787 VIAF 136752806 ISNI 0000000121654802 LCCN n83019688 SUDOC 026393549 NKC ko2007416902 WorldCat institution QS P195 Q3329787 phrarachwngaewrsay chuxinphasatnchbb Chateau de Versailleshnwynganaem Palace and Park of Versailles thitng Chateau de Versailles Place d Armes 78000 aewrsay Category Yvelines LangSwitch Error no default praethsfrngessphikd 48 48 17 ehnux 2 07 13 tawnxxk cdtngkhunemux 2166 hrux 2167 2332 hrux 2333 date QS P 1500 00 00T00 00 00Z 6 P580 1624 00 00T00 00 00Z 9 P582 1790 00 00T00 00 00Z 9 built 2379 hrux 2380 opened to publicewbist www chateauversailles fr ngankhwbkhumraykarhlkthan Q2946 VIAF 127977992 ISNI 0000000417949458 ULAN 500312482 OSM 1149002 UNESCO 83 WorldCat institution QS P195 Q2946rhskarthuxkhrxng MV 5419 Museum of the History of France INV DESS 1164 phrarachwngaewrsay prawtikhxngwtthuni Provenance Francois Charles Buteux en execute la bordure de bois sculpte et dore AN O 1 1921 B 1775 le pastel est transporte par de la Surintendance dans l appartement du roi a Versailles avec le portrait de la dauphine Marie Josephe de Saxe au pastel par Maurice Quentin de La Tour O 1 1934 B 1778 les deux oeuvres se trouvent dans le cabinet de la pendule de Versailles 1er janvier 1791 vraisemblablement saisie revolutionnaire des collections royales a Versailles envoi au musee de Louvre avant 1810 inscrit sur l inventaire du cabinet des dessins du Louvre depose au musee de Versailles 6 mai 1896 aehlngxangxing http collections chateauversailles fr d04a7c56 4f29 4dd6 99f8 c64e41d43d23 https photo rmn fr archive 22 535334 2C6NU0AYSMM66 html Joconde work ID 50350013203 ngankhwbkhumraykarhlkthan Q112967087 Joconde 50350013203thima phuthayphaph http www images chapitre com ima2 original 513 5715513 2487171 jpgewxrchnxun Versailles MV 6583 karxnuyatichsiththi phaphniepnphaphthiekidcakkarthasaenaphaphhruxsilpkrrmsxngmiti sungtwphaphtnchbbthithukthasannepnsatharnsmbtidwyehtuphltxipni Public domain Public domain false falsenganniepnsatharnsmbti inpraethstnkaenidaelapraethsxun thirayaewlakarkhumkhrxnglikhsiththinxykwa 100 pihlngcakphusrangsrrkhnganesiychiwit nganniepnsatharnsmbtiinshrthxemrika enuxngcakidrbkarephyaephr hruxkhuncdthaebiyntxsanknganlikhsiththiaehngshrth kxnwnthi 1 mkrakhm kh s 1929iflniidthukrabuwaimmikhxcakdphayitkdhmaylikhsiththi rwmthungsiththithiekiywkhxngaelathiiklekhiyngknhttps creativecommons org publicdomain mark 1 0 PDM Creative Commons Public Domain Mark 1 0 false false mulnithiwikiphiediymimummxngxyangepnthangkarinkrniniwa karthasaenaphaphhruxsilpkrrmsxngmitithiepnsatharnsmbti thuxwaphaphthiidcakkarthasaenaepnsatharnsmbti karxangphlngandngklawepnnganswnbukhkhlepnkarkhdtxaenwkhidekiywkbsatharnsmbti sahrbkhxmulephimetim duthi emuxidcaichpay PD Art karthasaenakhxngphaphnisungepnsatharnsmbti thuxidwaphaphthiekidcakkarthasaenaepnsatharnsmbtiechnkn oprdthrabwakarnaphaphniipichxacthukcakdhruxhamichinekhtxanacsalkhxngthan thngnikhunkbkdhmaythxngthinthibngkhbichinphunthinn duephimthi karnaphaphhruxsilpkrrmsxngmitiipichkhabrryayodyyxithyephimkhabrryaythrrthdediywephuxkhyaykhwamwaiflnimixairixethmthiaesdngxyuiniflniprakxbdwyThe Dauphin Louis of France 1729 1765 son of Louis XV xngkvsdigital representation of xngkvsThe Dauphin Louis of France 1729 1765 son of Louis XV xngkvshwkhxhlkThe Dauphin Louis of France 1729 1765 son of Louis XV xngkvsmedia type xngkvsimage jpegchecksum xngkvs7a862bcac6156e8662fbe9a1f03c8a93a7088306withikarkahnd SHA 1 xngkvsdata size xngkvs31 043 ibtkhwamsung589 phikeslkhwamkwang468 phikesl prawtiifl khlikwnthi ewlaephuxduiflthipraktinkhnann wnthi ewlarupyxkhnadphuichkhwamehnpccubn02 07 3 thnwakhm 2554468 589 30 kiolibt Information Description en 1 int filedesc Artwork artist Creator Alexander Roslin title Title 1 Le Dauphin Louis de France 1729 1765 fils de Louis XV lang fr translation en The Dauphin of Fran hnathimiphaphni hnatxipni oyngmathiphaphni rayphranamrchthayathfrngess karichiflkhamokhrngkar wikixuntxipniichiflni karichbn vi wikipedia org Louis Ferdinand của Phap karichbn www wikidata org Wikidata WikiProject sum of all paintings Collection Museum of the History of France Wikidata WikiProject sum of all paintings Creator Alexander Roslin Wikidata WikiProject Men Portraits of Men 1760 1769 Q112967087khxmulekiywkbphaph phaphnimikhxmulephimetim sungswnihymacakklxngdicitxlhruxsaeknenxrthisamarthekbkhxmuldngklawiwrwmkbphaphid thaphaphnithukprbprungaekikhhruxepliynaeplngcakedim khxmulbangxyangcayngkhngimepliynaeplngehmuxnphaphthithukprbprungaekikhnnsxftaewrthiichPicasarhsphaphf17ea56f80def880d166abce23362822